CAPG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CAPG
Protein CAPG PDB 1j72.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CAPG, AFCP, HEL-S-66, MCP, capping actin protein, gelsolin like
Зовнішні ІД OMIM: 153615 MGI: 1098259 HomoloGene: 37523 GeneCards: CAPG
Шаблон експресії
PBB GE CAPG 201850 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001042534
NM_001271395
NM_001271415
NM_007599
RefSeq (білок)
н/д
Локус (UCSC) Хр. 2: 85.39 – 85.42 Mb Хр. 6: 72.52 – 72.54 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CAPG (англ. Capping actin protein, gelsolin like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 348 амінокислот, а молекулярна маса — 38 499[4].

Послідовність амінокислот
1020304050
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLV
LHNGPEEVSHLHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQG
NESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLYQVKGKKNIRA
TERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDS
ERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAA
LYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK

Кодований геном білок за функцією належить до кепінгів актину. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, ядрі. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mishra V.S., Henske E.P., Kwiatkowski D.J., Southwick F.S. (1994). The human actin-regulatory protein cap G: gene structure and chromosome location.. Genomics 23: 560 — 565.  PubMed DOI:10.1006/geno.1994.1543
  • Southwick F.S. (1995). Gain-of-function mutations conferring actin-severing activity to human macrophage cap G.. J. Biol. Chem. 270: 45 — 48.  PubMed DOI:10.1074/jbc.270.1.45
  • Dabiri G.A., Young C.L., Rosenbloom J., Southwick F.S. (1992). Molecular cloning of human macrophage capping protein cDNA. A unique member of the gelsolin/villin family expressed primarily in macrophages.. J. Biol. Chem. 267: 16545 — 16552.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1474 (англ.). Архів оригіналу за 14 жовтня 2017. Процитовано 22 серпня 2017. 
  4. UniProt, P40121 (англ.). Архів оригіналу за 29 серпня 2017. Процитовано 22 серпня 2017. 

Див. також[ред. | ред. код]