CASR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CASR
Ідентифікатори
Символи parathyroid Ca(2+)-sensing receptor 1parathyroid cell calcium-sensing receptor 1extracellular calcium-sensing receptorCASRPCaR1
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE CASR 210577 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CASR (англ. Calcium sensing receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 1 078 амінокислот, а молекулярна маса — 120 675[2].

Послідовність амінокислот
1020304050
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQD
LKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDT
CNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVS
TAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADI
IEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEE
EIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKE
FWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDEN
ISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCA
DIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPED
GSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGT
RKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNREL
SYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTN
RVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSS
YRNQELEDEIIFITCHEGSLMALGFLIGYTCLLAAICFFFAFKSRKLPEN
FNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIAILAASFGLLA
CIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTL
PQQQRSQQQPRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEA
QKSSDTLTRHEPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEEL
SPALVVSSSQSFVISGGGSTVTENVVNS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Aida K., Koishi S., Tawata M., Onaya T. (1995). Molecular cloning of a putative Ca(2+)-sensing receptor cDNA from human kidney.. Biochem. Biophys. Res. Commun. 214: 524 — 529.  PubMed DOI:10.1006/bbrc.1995.2318
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bikle D.D., Ratnam A., Mauro T., Harris J., Pillai S. (1996). Changes in calcium responsiveness and handling during keratinocyte differentiation. Potential role of the calcium receptor.. J. Clin. Invest. 97: 1085 — 1093.  PubMed DOI:10.1172/JCI118501
  • Huang Y., Niwa J., Sobue G., Breitwieser G.E. (2006). Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin.. J. Biol. Chem. 281: 11610 — 11617.  PubMed DOI:10.1074/jbc.M513552200
  • Muto T., Tsuchiya D., Morikawa K., Jingami H. (2007). Structures of the extracellular regions of the group II/III metabotropic glutamate receptors.. Proc. Natl. Acad. Sci. U.S.A. 104: 3759 — 3764.  PubMed DOI:10.1073/pnas.0611577104
  • Zhuang X., Adipietro K.A., Datta S., Northup J.K., Ray K. (2010). Rab1 small GTP-binding protein regulates cell surface trafficking of the human calcium-sensing receptor.. Endocrinology 151: 5114 — 5123.  PubMed DOI:10.1210/en.2010-0422

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:1514 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P41180 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]