CD22

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CD22
Ідентифікатори
Символи BL-CAMSiglec-2T-cell surface antigen Leu-14B-cell receptor CD22B-lymphocyte cell adhesion moleculeCD22 antigenCD22sialic acid-binding Ig-like lectin 2
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE CD22 38521 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CD22 (англ. CD22 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 847 амінокислот, а молекулярна маса — 95 348[2].

Послідовність амінокислот
1020304050
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALD
GDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNK
NCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPE
IQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFT
RSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTP
SDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE
FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAEN
ILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPS
VTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALN
VQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLL
GKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVK
VQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI
LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLG
CYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALH
KRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Білок має сайт для зв'язування з лектинами. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Stamenkovic I., Seed B. (1990). The B-cell antigen CD22 mediates monocyte and erythrocyte adhesion.. Nature 345: 74 — 77.  PubMed DOI:10.1038/345074a0
  • Wilson G.L., Fox C.H., Fauci A.S., Kehrl J.H. (1991). cDNA cloning of the B cell membrane protein CD22: a mediator of B-B cell interactions.. J. Exp. Med. 173: 137 — 146.  PubMed DOI:10.1084/jem.173.1.137
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tuscano J.M., Engel P., Tedder T.F., Agarwal A., Kehrl J.H. (1996). Involvement of p72syk kinase, p53/56lyn kinase and phosphatidyl inositol-3 kinase in signal transduction via the human B lymphocyte antigen CD22.. Eur. J. Immunol. 26: 1246 — 1252.  PubMed DOI:10.1002/eji.1830260610
  • Tedder T.F., Tuscano J., Sato S., Kehrl J.H. (1997). CD22, a B lymphocyte-specific adhesion molecule that regulates antigen receptor signaling.. Annu. Rev. Immunol. 15: 481 — 504.  PubMed DOI:10.1146/annurev.immunol.15.1.481
  • Powell L.D., Sgroi D., Sjoberg E.R., Stamenkovic I., Varki A. (1993). Natural ligands of the B cell adhesion molecule CD22 beta carry N-linked oligosaccharides with alpha-2,6-linked sialic acids that are required for recognition.. J. Biol. Chem. 268: 7019 — 7027.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:1643 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P20273 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]