CD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CD4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CD4, CD4mut, CD4 molecule, OKT4D, IMD79
Зовнішні ІД OMIM: 186940 MGI: 88335 HomoloGene: 513 GeneCards: CD4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013488
RefSeq (білок)
NP_038516
Локус (UCSC) Хр. 12: 6.79 – 6.82 Mb Хр. 6: 124.84 – 124.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CD4 (англ. CD4 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 51 111[4].

Послідовність амінокислот
1020304050
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQ
FHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLK
IEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSS
PSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIV
VLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKS
WITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAK
VSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALI
VLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR
FQKTCSPI

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу вірусу, рецепторів. Задіяний у таких біологічних процесах, як адаптивний імунітет, імунітет, взаємодія хазяїн-вірус. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Littman D.R., Maddon P.J., Axel R. (1988). Corrected CD4 sequence.. Cell 55: 541 — 541.  PubMed DOI:10.1016/0092-8674(88)90211-5
  • Ansari-Lari M.A., Shen Y., Muzny D.M., Lee W., Gibbs R.A. (1997). Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.. Genome Res. 7: 268 — 280.  PubMed DOI:10.1101/gr.7.3.268
  • Hodge T.W., Sasso D.R., McDougal J.S. (1991). Humans with OKT4-epitope deficiency have a single nucleotide base change in the CD4 gene, resulting in substitution of TRP240 for ARG240.. Hum. Immunol. 30: 99 — 104.  PubMed DOI:10.1016/0198-8859(91)90077-M
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fomsgaard A., Hirsch V.M., Johnson P.R. (1992). Cloning and sequences of primate CD4 molecules: diversity of the cellular receptor for simian immunodeficiency virus/human immunodeficiency virus.. Eur. J. Immunol. 22: 2973 — 2981.  PubMed DOI:10.1002/eji.1830221132
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1678 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P01730 (англ.). Архів оригіналу за 9 жовтня 2017. Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]