CD55

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CD55
Protein CD55 PDB 1h03.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CD55, CR, CROM, DAF, TC, CD55 molecule (Cromer blood group), CHAPLE
Зовнішні ІД OMIM: 125240 MGI: 104849 HomoloGene: 479 GeneCards: CD55
Пов'язані генетичні захворювання
protein-losing enteropathy[1]
Шаблон експресії
PBB GE CD55 201925 s at fs.png

PBB GE CD55 201926 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007827
NM_001317361
RefSeq (білок)
NP_000565
NP_001108224
NP_001287831
NP_001287832
NP_001287833
NP_001304290
NP_031853
Локус (UCSC) Хр. 1: 207.32 – 207.39 Mb Хр. 1: 130.39 – 130.42 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CD55 (англ. CD55 molecule (Cromer blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 381 амінокислоту, а молекулярна маса — 41 400[5].

Послідовність амінокислот
1020304050
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALE
GRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEV
PTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK
WSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGST
SSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVT
YACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG
TTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу вірусу, рецепторів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, взаємодія хазяїн-вірус, шлях активації комплементу. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ewulonu U.K., Ravi L., Medof M.E. (1991). Characterization of the decay-accelerating factor gene promoter region.. Proc. Natl. Acad. Sci. U.S.A. 88: 4675 — 4679.  PubMed DOI:10.1073/pnas.88.11.4675
  • Sugita Y., Negoro T., Matsuda T., Sakamoto T., Tomita M. (1986). Improved method for the isolation and preliminary characterization of human DAF (decay-accelerating factor).. J. Biochem. 100: 143 — 150.  PubMed DOI:10.1093/oxfordjournals.jbchem.a121686
  • Blomqvist S., Savolainen C., Raman L., Roivainen M., Hovi T. (2002). Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features.. J. Clin. Microbiol. 40: 4218 — 4223.  PubMed DOI:10.1128/JCM.40.11.4218-4223.2002
  • Mizuhashi K., Chaya T., Kanamoto T., Omori Y., Furukawa T. (2015). Obif, a transmembrane protein, is required for bone mineralization and spermatogenesis in mice.. PLoS ONE 10: E0133704 — E0133704.  PubMed DOI:10.1371/journal.pone.0133704
  • Moran P., Raab H., Kohr W.J., Caras I.W. (1991). Glycophospholipid membrane anchor attachment. Molecular analysis of the cleavage/attachment site.. J. Biol. Chem. 266: 1250 — 1257.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]