CDKN1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CDKN1A
Ідентифікатори
Символи cyclin-dependent kinase inhibitor 1cyclin-dependent kinase inhibitor 1A (p21Cip1)CDK-interaction protein 1CDKN1ACDK-interacting protein 1DNA synthesis inhibitorp21wild-type p53-activated fragment 1melanoma differentiation associated protein 6Melanoma differentiation-associated protein 6MDA-6
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CDKN1A (англ. Cyclin dependent kinase inhibitor 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 164 амінокислот, а молекулярна маса — 18 119[2].

Послідовність амінокислот
1020304050
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWN
FDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPA
LLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF
YHSKRRLIFSKRKP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Harper J.W., Adami G.R., Wei N., Keyomarsi K., Elledge S.J. (1993). The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases.. Cell 75: 805 — 816.  PubMed DOI:10.1016/0092-8674(93)90499-G
  • Noda A., Ning Y., Venable S.F., Pereira-Smith O.M., Smith J.R. (1994). Cloning of senescent cell-derived inhibitors of DNA synthesis using an expression screen.. Exp. Cell Res. 211: 90 — 98.  PubMed DOI:10.1006/excr.1994.1063
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Scott M.T., Morrice N., Ball K.L. (2000). Reversible phosphorylation at the C-terminal regulatory domain of p21(Waf1/Cip1) modulates proliferating cell nuclear antigen binding.. J. Biol. Chem. 275: 11529 — 11537.  PubMed DOI:10.1074/jbc.275.15.11529
  • Coulombe P., Rodier G., Bonneil E., Thibault P., Meloche S. (2004). N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome.. Mol. Cell. Biol. 24: 6140 — 6150.  PubMed DOI:10.1128/MCB.24.14.6140-6150.2004
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:1784 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, P38936 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]