CDKN2B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CDKN2B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDKN2B, CDK4I, INK4B, MTS2, P15, TP15, p15INK4b, cyclin-dependent kinase inhibitor 2B, cyclin dependent kinase inhibitor 2B
Зовнішні ІД OMIM: 600431 MGI: 104737 HomoloGene: 55859 GeneCards: CDKN2B
Шаблон експресії
PBB GE CDKN2B 207530 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_078487
NM_004936
NM_007670
RefSeq (білок)
NP_004927
NP_511042
NP_031696
Локус (UCSC) Хр. 9: 22 – 22.01 Mb Хр. 4: 89.31 – 89.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDKN2B (англ. Cyclin dependent kinase inhibitor 2B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 138 амінокислот, а молекулярна маса — 14 722[4].

Послідовність амінокислот
1020304050
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRA
IQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLH
RAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Задіяний у таких біологічних процесах, як клітинний цикл, альтернативний сплайсинг. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Hannon G.J., Beach D. (1994). p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.. Nature 371: 257 — 261.  PubMed DOI:10.1038/371257a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yuan C., Selby T.L., Li J., Byeon I.J., Tsai M.D. (2000). Tumor suppressor INK4: refinement of p16INK4A structure and determination of p15INK4B structure by comparative modeling and NMR data.. Protein Sci. 9: 1120 — 1128.  PubMed DOI:10.1110/ps.9.6.1120
  • Tsubari M., Tiihonen E., Laiho M. (1997). Cloning and characterization of p10, an alternatively spliced form of p15 cyclin-dependent kinase inhibitor.. Cancer Res. 57: 2966 — 2973.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1788 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P42772 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]