CDX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CDX1
Ідентифікатори
Символи CDX1, caudal type homeobox 1, Homeobox protein CDX-1
Зовнішні ІД OMIM: 600746 MGI: 88360 HomoloGene: 1366 GeneCards: CDX1
Шаблон експресії
PBB GE CDX1 206430 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001804
NM_009880
RefSeq (білок)
NP_001795
NP_034010
Локус (UCSC) Хр. 5: 150.17 – 150.18 Mb Хр. 18: 61.02 – 61.04 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDX1 (англ. Caudal type homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 265 амінокислот, а молекулярна маса — 28 138[4].

Послідовність амінокислот
1020304050
MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSH
VEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSP
VPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGK
TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKI
WFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSL
LATSSPMPVKEEFLP

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Bonner C.A., Lofus S.K., Wasmuth J.J. (1995). Isolation, characterization, and precise physical localization of human CDX1, a caudal-type homeobox gene.. Genomics 28: 206 — 211.  PubMed DOI:10.1006/geno.1995.1132
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Serra R.W., Fang M., Park S.M., Hutchinson L., Green M.R. (2014). A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.. Elife 3: E02313 — E02313.  PubMed DOI:10.7554/eLife.02313

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1805 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P47902 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]