CEBPB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPB
1gtw.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CEBPB, C/EBP-beta, IL6DBP, NF-IL6, TCF5, CCAAT/enhancer binding protein beta, CCAAT enhancer binding protein beta
Зовнішні ІД OMIM: 189965 MGI: 88373 HomoloGene: 3807 GeneCards: CEBPB
Шаблон експресії
PBB GE CEBPB 212501 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005194
NM_001285878
NM_001285879
NM_001287738
NM_001287739
NM_009883
RefSeq (білок)
NP_001272807
NP_001272808
NP_005185
NP_001274667
NP_001274668
NP_034013
Локус (UCSC) Хр. 20: 50.19 – 50.19 Mb Хр. 2: 167.69 – 167.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPB (англ. CCAAT/enhancer binding protein beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 345 амінокислот, а молекулярна маса — 36 106[4].

Послідовність амінокислот
1020304050
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPP
AARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAA
PPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKG
ALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMA
AGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYA
GAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kinoshita S., Akira S., Kishimoto T. (1992). A member of the C/EBP family, NF-IL6 beta, forms a heterodimer and transcriptionally synergizes with NF-IL6.. Proc. Natl. Acad. Sci. U.S.A. 89: 1473 — 1476.  PubMed DOI:10.1073/pnas.89.4.1473
  • Chinery R., Brockman J.A., Dransfield D.T., Coffey R.J. (1997). Antioxidant-induced nuclear translocation of CCAAT/enhancer-binding protein beta. A critical role for protein kinase A-mediated phosphorylation of Ser299.. J. Biol. Chem. 272: 30356 — 30361.  PubMed DOI:10.1074/jbc.272.48.30356
  • Podust L.M., Krezel A.M., Kim Y. (2001). Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA.. J. Biol. Chem. 276: 505 — 513.  PubMed DOI:10.1074/jbc.M005594200
  • Buck M., Poli V., Hunter T., Chojkier M. (2001). C/EBPbeta phosphorylation by RSK creates a functional XEXD caspase inhibitory box critical for cell survival.. Mol. Cell 8: 807 — 816.  PubMed DOI:10.1016/S1097-2765(01)00374-4
  • Zhu Y., Saunders M.A., Yeh H., Deng W.G., Wu K.K. (2002). Dynamic regulation of cyclooxygenase-2 promoter activity by isoforms of CCAAT/enhancer-binding proteins.. J. Biol. Chem. 277: 6923 — 6928.  PubMed DOI:10.1074/jbc.M108075200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1834 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P17676 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]