CHRM3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CHRM3
4daj.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CHRM3, EGBRS, HM3, PBS, cholinergic receptor muscarinic 3
Зовнішні ІД OMIM: 118494 MGI: 88398 HomoloGene: 20191 GeneCards: CHRM3
Пов'язані генетичні захворювання
Епілепсія, Prune belly syndrome[1]
Реагує на сполуку
Ацетилхолін, arecoline, bethanechol, milameline, Пілокарпін, sabcomeline, xanomeline, Бруцин, vinburnine, vincamine, aclidinium, AFDX384, Амітриптилін, Біпериден, clidinium, darifenacin, dicyclomine, glycopyrrolate, hexocyclium, himbacine, methoctramine free base, Оксибутинін, pirenzepine, propantheline, Хінукліділ-3-бензилат, Толтеродин, tropicamide, umeclidinium, oxotremorine[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033269
RefSeq (білок)
NP_150372
Локус (UCSC) Хр. 1: 239.39 – 239.92 Mb Хр. 13: 9.88 – 10.36 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CHRM3 (англ. Cholinergic receptor muscarinic 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 590 амінокислот, а молекулярна маса — 66 128[6].

Послідовність амінокислот
1020304050
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFS
SPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLK
TVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYV
ASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLW
APAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTIL
YWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSA
SSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVD
LERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKS
TATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAF
IITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKT
FRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

Література[ред. | ред. код]

  • Bonner T.I., Young A.C., Brann M.R., Buckley N.J. (1988). Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes.. Neuron 1: 403 — 410.  PubMed DOI:10.1016/0896-6273(88)90190-0
  • Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes.. Mol. Biol. Evol. 21: 936 — 944.  PubMed DOI:10.1093/molbev/msh100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Speek M. (2001). Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.. Mol. Cell. Biol. 21: 1973 — 1985.  PubMed DOI:10.1128/MCB.21.6.1973-1985.2001
  • Iverson H.A., Fox D. III, Nadler L.S., Klevit R.E., Nathanson N.M. (2005). Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal.. J. Biol. Chem. 280: 24568 — 24575.  PubMed DOI:10.1074/jbc.M501264200
  • Yang J., Williams J.A., Yule D.I., Logsdon C.D. (1995). Mutation of carboxyl-terminal threonine residues in human M3 muscarinic acetylcholine receptor modulates the extent of sequestration and desensitization.. Mol. Pharmacol. 48: 477 — 485.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]