CLDN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CLDN1
Ідентифікатори
Символи CLDN1, CLD1, ILVASC, SEMP1, claudin 1
Зовнішні ІД OMIM: 603718 MGI: 1276109 HomoloGene: 9620 GeneCards: CLDN1
Шаблон експресії
PBB GE CLDN1 218182 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021101
NM_016674
RefSeq (білок)
NP_066924
NP_057883
Локус (UCSC) Хр. 3: 190.31 – 190.32 Mb Хр. 16: 26.36 – 26.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CLDN1 (англ. Claudin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 211 амінокислот, а молекулярна маса — 22 744[4].

Послідовність амінокислот
1020304050
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGL
WMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATV
GMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYD
PMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYP
KPAPSSGKDYV

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів. Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у клітинній мембрані, мембрані, клітинних контактах, щільних контактах.

Література[ред. | ред. код]

  • Kraemer F., White K., Kubbies M., Swisshelm K.L., Weber B.H.F. (2000). Genomic organization of claudin-1 and its assessment in hereditary and sporadic breast cancer.. Hum. Genet. 107: 249 — 256.  PubMed DOI:10.1007/s004390000375
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Che P., Tang H., Li Q. (2013). The interaction between claudin-1 and dengue viral prM/M protein for its entry.. Virology 446: 303 — 313.  PubMed DOI:10.1016/j.virol.2013.08.009

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2032 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, O95832 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]