CNR1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CNR1
Ідентифікатори
Символи cannabinoid receptor 1cannabinoid receptor 1 (brain)CANN6CNR1central cannabinoid receptor
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CNR1 (англ. Cannabinoid receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 472 амінокислот, а молекулярна маса — 52 858[2].

Послідовність амінокислот
1020304050
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPL
TSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGE
NFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCR
PSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASF
TASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVL
PLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILV
VLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALR
SKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCI
KSTVKIAKVTMSVSTDTSAEAL

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, мітохондрії, клітинних відростках, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Gerard C., Mollereau C., Vassart G., Parmentier M. (1990). Nucleotide sequence of a human cannabinoid receptor cDNA.. Nucleic Acids Res. 18: 7142 — 7142.  PubMed DOI:10.1093/nar/18.23.7142
  • Gerard C., Mollereau C., Vassart G., Parmentier M. (1991). Molecular cloning of a human cannabinoid receptor which is also expressed in testis.. Biochem. J. 279: 129 — 134.  PubMed DOI:10.1042/bj2790129
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2159 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, P21554 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]