CPT1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CPT1A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CPT1A, carnitine palmitoyltransferase 1A (liver), CPT1, CPT1-L, L-CPT1, carnitine palmitoyltransferase 1A
Зовнішні ІД OMIM: 600528 MGI: 1098296 HomoloGene: 1413 GeneCards: CPT1A
Пов'язані генетичні захворювання
Ожиріння, lipid metabolism disorder, carnitine palmitoyltransferase I deficiency[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001031847
NM_001876
NM_013495
RefSeq (білок)
NP_001027017
NP_001867
NP_038523
Локус (UCSC) Хр. 11: 68.75 – 68.84 Mb Хр. 19: 3.32 – 3.39 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CPT1A (англ. Carnitine palmitoyltransferase 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 773 амінокислот, а молекулярна маса — 88 368[5].

Послідовність амінокислот
1020304050
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGI
ITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQ
TKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIW
MGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFK
RMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMV
NSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHD
GRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFG
RGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYD
RWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAE
DGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
FVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTG
SGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLE
NNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRF
GRHLKEAMTDIITLFGLSSNSKK

Кодований геном білок за функціями належить до трансфераз, ацилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм жирних кислот, метаболізм ліпідів, транспорт, ацетилювання, альтернативний сплайсинг. Локалізований у мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Napal L., Marrero P.F., Haro D. (2005). An intronic peroxisome proliferator-activated receptor-binding sequence mediates fatty acid induction of the human carnitine palmitoyltransferase 1A.. J. Mol. Biol. 354: 751 — 759.  PubMed DOI:10.1016/j.jmb.2005.09.097
  • Rao J.N., Warren G.Z., Estolt-Povedano S., Zammit V.A., Ulmer T.S. (2011). An environment-dependent structural switch underlies the regulation of carnitine palmitoyltransferase 1A.. J. Biol. Chem. 286: 42545 — 42554.  PubMed DOI:10.1074/jbc.M111.306951
  • Stoler J.M., Sabry M.A., Hanley C., Hoppel C.L., Shih V.E. (2004). Successful long-term treatment of hepatic carnitine palmitoyltransferase I deficiency and a novel mutation.. J. Inherit. Metab. Dis. 27: 679 — 684.  PubMed DOI:10.1023/B:BOLI.0000042979.42120.55
  • Bennett M.J., Boriack R.L., Narayan S., Rutledge S.L., Raff M.L. (2004). Novel mutations in CPT 1A define molecular heterogeneity of hepatic carnitine palmitoyltransferase I deficiency.. Mol. Genet. Metab. 82: 59 — 63.  PubMed DOI:10.1016/j.ymgme.2004.02.004

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]