CRYAB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CRYAB
Protein CRYAB PDB 2KLR.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CRYAB, CMD1II, CRYA2, CTPP2, CTRCT16, HEL-S-101, HSPB5, MFM2, crystallin alpha B
Зовнішні ІД OMIM: 123590 MGI: 88516 HomoloGene: 68209 GeneCards: CRYAB
Пов'язані генетичні захворювання
myofibrillar myopathy 2, dilated cardiomyopathy 1II[1]
Шаблон експресії
PBB GE CRYAB 209283 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001289782
NM_001289784
NM_001289785
NM_009964
RefSeq (білок)
NP_001276711
NP_001276713
NP_001276714
NP_034094
Локус (UCSC) Хр. 11: 111.91 – 111.92 Mb Хр. 9: 50.66 – 50.67 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CRYAB (англ. Crystallin alpha B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 175 амінокислот, а молекулярна маса — 20 159[5].

Послідовність амінокислот
1020304050
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR
PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV
HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
QVSGPERTIPITREEKPAVTAAPKK

Кодований геном білок за функціями належить до шаперонів, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Kramps J.A., de Man B.M., de Jong W.W. (1977). The primary structure of the B2 chain of human alpha-crystallin.. FEBS Lett. 74: 82 — 84.  PubMed DOI:10.1016/0014-5793(77)80757-6
  • Dubin R.A., Ally A.H., Chung S., Piatigorsky J. (1990). Human alpha B-crystallin gene and preferential promoter function in lens.. Genomics 7: 594 — 601.  PubMed DOI:10.1016/0888-7543(90)90204-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Iwaki T., Kume-Iwaki A., Liem R.K.H., Goldman J.E. (1989). Alpha B-crystallin is expressed in non-lenticular tissues and accumulates in Alexander's disease brain.. Cell 57: 71 — 78.  PubMed DOI:10.1016/0092-8674(89)90173-6
  • Fujii N., Ishibashi Y., Satoh K., Fujino M., Harada K. (1994). Simultaneous racemization and isomerization at specific aspartic acid residues in alpha B-crystallin from the aged human lens.. Biochim. Biophys. Acta 1204: 157 — 163.  PubMed DOI:10.1016/0167-4838(94)90003-5
  • Hanson S.R.A., Hasan A., Smith D.L., Smith J.B. (2000). The major in vivo modifications of the human water-insoluble lens crystallins are disulfide bonds, deamidation, methionine oxidation and backbone cleavage.. Exp. Eye Res. 71: 195 — 207.  PubMed DOI:10.1006/exer.2000.0868

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]