CSF2RB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CSF2RB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5, colony stimulating factor 2 receptor beta common subunit, betaGMR, colony stimulating factor 2 receptor subunit beta
Зовнішні ІД OMIM: 138981 MGI: 1339760 HomoloGene: 339 GeneCards: CSF2RB
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000395
NM_001287389
NM_007781
RefSeq (білок)
NP_000386
NP_001274318
NP_031807
Локус (UCSC) Хр. 22: 36.91 – 36.94 Mb Хр. 15: 78.28 – 78.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CSF2RB (англ. Colony stimulating factor 2 receptor beta common subunit) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 897 амінокислот, а молекулярна маса — 97 336[4].

Послідовність амінокислот
1020304050
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADT
QDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPC
QSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLL
TWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPE
HLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLEC
FFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKD
GDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALP
ALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMWVLALIVI
FLTIAVLLALRFCGIYGYRLRRKWEEKIPNPSKSHLFQNGSAELWPPGSM
SAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIEDPKHVCDPPS
GPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQ
AVEVERRPSQGAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSG
DTEDPGVASGYVSSADLVFTPNSGASSVSLVPSLGLPSDQTPSLCPGLAS
GPPGAPGPVKSGFEGYVELPPIEGRSPRSPRNNPVPPEAKSPVLNPGERP
ADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKN
LDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у мембрані.

Література[ред. | ред. код]

  • Carr P.D., Conlan F., Ford S., Ollis D.L., Young I.G. (2006). An improved resolution structure of the human beta common receptor involved in IL-3, IL-5 and GM-CSF signalling which gives better definition of the high-affinity binding epitope.. Acta Crystallogr. F 62: 509 — 513.  PubMed DOI:10.1107/S1744309106016812

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2436 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, P32927 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]