CTLA4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CTLA4
CTLA4 Crystal Structure.rsh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12, cytotoxic T-lymphocyte associated protein 4
Зовнішні ІД OMIM: 123890 MGI: 88556 HomoloGene: 3820 GeneCards: CTLA4
Пов'язані генетичні захворювання
Ревматоїдний артрит, Гіпотиреоз, Цукровий діабет тип 1[1]
Шаблон експресії
PBB GE CTLA4 221331 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001037631
NM_005214
NM_001281976
NM_009843
RefSeq (білок)
NP_001032720
NP_005205
NP_001268905
NP_033973
Локус (UCSC) Хр. 2: 203.87 – 203.87 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CTLA4 (англ. Cytotoxic T-lymphocyte associated protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 223 амінокислот, а молекулярна маса — 24 656[5].

Послідовність амінокислот
1020304050
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASS
RGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD
SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIY
VIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGV
YVKMPPTEPECEKQFQPYFIPIN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dariavach P., Mattei M.-G., Golstein P., Lefranc M.-P. (1988). Human Ig superfamily CTLA-4 gene: chromosomal localization and identity of protein sequence between murine and human CTLA-4 cytoplasmic domains.. Eur. J. Immunol. 18: 1901 — 1905.  PubMed DOI:10.1002/eji.1830181206
  • Schneider H., Schwartzberg P.L., Rudd C.E. (1998). Resting lymphocyte kinase (Rlk/Txk) phosphorylates the YVKM motif and regulates PI 3-kinase binding to T-cell antigen CTLA-4.. Biochem. Biophys. Res. Commun. 252: 14 — 19.  PubMed DOI:10.1006/bbrc.1998.9559
  • Chikuma S., Murakami M., Tanaka K., Uede T. (2000). Janus kinase 2 is associated with a box 1-like motif and phosphorylates a critical tyrosine residue in the cytoplasmic region of cytotoxic T lymphocyte associated molecule-4.. J. Cell. Biochem. 78: 241 — 250.  PubMed DOI:10.1002/(SICI)1097-4644(20000801)78:2<241::AID-JCB7>3.0.CO;2-K
  • Darlington P.J., Kirchhof M.G., Criado G., Sondhi J., Madrenas J. (2005). Hierarchical regulation of CTLA-4 dimer-based lattice formation and its biological relevance for T cell inactivation.. J. Immunol. 175: 996 — 1004.  PubMed DOI:10.4049/jimmunol.175.2.996
  • Teft W.A., Kirchhof M.G., Madrenas J. (2006). A molecular perspective of CTLA-4 function.. Annu. Rev. Immunol. 24: 65 — 97.  PubMed DOI:10.1146/annurev.immunol.24.021605.090535

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]