CTNNBL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CTNNBL1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CTNNBL1, C20orf33, NAP, P14L, PP8304, dJ633O20.1, catenin beta like 1
Зовнішні ІД OMIM: 611537 MGI: 1913892 HomoloGene: 12003 GeneCards: CTNNBL1
Шаблон експресії
PBB GE CTNNBL1 221021 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001281495
NM_030877
NM_025680
RefSeq (білок)
NP_001268424
NP_110517
NP_079956
Локус (UCSC) Хр. 20: 37.69 – 37.87 Mb Хр. 2: 157.74 – 157.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CTNNBL1 (англ. Catenin beta like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 563 амінокислот, а молекулярна маса — 65 173[4].

Послідовність амінокислот
1020304050
MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVE
EADDDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELR
IKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLL
GHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQN
LERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLK
AKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHN
PSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISR
SSALKVLDHAMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTE
KEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLG
AMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIM
AEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRE
NEQKRILGLLENF

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, процесинг мРНК, сплайсинг мРНК, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Jabbour L.S., Welter J.F., Kollar J., Hering T.M. (2003). Sequence, gene structure, and expression pattern of CTNNBL1, a minor-class intron-containing gene - evidence for a role in apoptosis.. Genomics 81: 292 — 303.  PubMed DOI:10.1016/S0888-7543(02)00038-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Huang X., Wang G., Wu Y., Du Z. (2013). The structure of full-length human CTNNBL1 reveals a distinct member of the armadillo-repeat protein family.. Acta Crystallogr. D 69: 1598 — 1608.  PubMed DOI:10.1107/S0907444913011360

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15879 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q8WYA6 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]