CXCL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CXCL2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CXCL2, CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2, C-X-C motif chemokine ligand 2
Зовнішні ІД MGI: 108068 HomoloGene: 105490 GeneCards: CXCL2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002089
NM_008176
RefSeq (білок)
NP_002080
NP_032202
Локус (UCSC) Хр. 4: 74.1 – 74.1 Mb Хр. 5: 90.89 – 90.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CXCL2 (англ. C-X-C motif chemokine ligand 2) – білок, який кодується однойменним геном, розташованим у людей на 4-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 11 389[4].

Послідовність амінокислот
1020304050
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQ
GIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM
LKNGKSN

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.

Література[ред. | ред. код]

  • Iida N., Grotendorst G.R. (1990). Cloning and sequencing of a new gro transcript from activated human monocytes: expression in leukocytes and wound tissue.. Mol. Cell. Biol. 10: 5596 — 5599.  PubMed DOI:10.1128/MCB.10.10.5596
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Qian Y.Q., Johanson K.O., McDevitt P. (1999). Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.. J. Mol. Biol. 294: 1065 — 1072.  PubMed DOI:10.1006/jmbi.1999.3333

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4603 (англ.). Процитовано 18 вересня 2017. 
  4. UniProt, P19875 (англ.). Процитовано 18 вересня 2017. 

Див. також[ред. | ред. код]