DCTN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DCTN1
Protein DCTN1 PDB 1txq.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DCTN1, DAP-150, DP-150, P135, dynactin subunit 1
Зовнішні ІД OMIM: 601143 MGI: 107745 HomoloGene: 3011 GeneCards: DCTN1
Пов'язані генетичні захворювання
Perry syndrome[1]
Шаблон експресії
PBB GE DCTN1 211780 x at fs.png

PBB GE DCTN1 201082 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001198866
NM_001198867
NM_007835
NM_001347310
RefSeq (білок)
NP_001185795
NP_001185796
NP_001334239
NP_031861
Локус (UCSC) Хр. 2: 74.36 – 74.39 Mb Хр. 6: 83.17 – 83.2 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DCTN1 (англ. Dynactin subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 278 амінокислот, а молекулярна маса — 141 695[5].

Послідовність амінокислот
1020304050
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGAT
LFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDG
ADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRP
KPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPV
LTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEK
HKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKG
SDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQ
ELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNL
EEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQ
KRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPP
ETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQL
SFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLD
FLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHI
KFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKK
IRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQ
LIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRET
VIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEE
TQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRG
PPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAM
RLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYR
KTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE
KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF
SCAAGFGQRHRLVLTQEQLHQLHSRLIS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт, клітинний цикл, поділ клітини, мітоз, поліморфізм, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • Collin G.B., Nishina P.M., Marshall J.D., Naggert J.K. (1998). Human DCTN1: genomic structure and evaluation as a candidate for Alstrom syndrome.. Genomics 53: 359 — 364.  PubMed DOI:10.1006/geno.1998.5542
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Holzbaur E.L.F., Tokito M.K. (1996). Localization of the DCTN1 gene encoding p150Glued to human chromosome 2p13 by fluorescence in situ hybridization.. Genomics 31: 398 — 399.  PubMed DOI:10.1006/geno.1996.0068
  • Tokito M.K., Howland D.S., Lee V.M.-Y., Holzbaur E.L.F. (1996). Functionally distinct isoforms of dynactin are expressed in human neurons.. Mol. Biol. Cell 7: 1167 — 1180.  PubMed DOI:10.1091/mbc.7.8.1167
  • Tokito M.K., Holzbaur E.L.F. (1998). The genomic structure of DCTN1, a candidate gene for limb-girdle muscular dystrophy.. Biochim. Biophys. Acta 1442: 432 — 436.  PubMed DOI:10.1016/S0167-4781(98)00195-X
  • Bu W., Su L.-K. (2003). Characterization of functional domains of human EB1 family proteins.. J. Biol. Chem. 278: 49721 — 49731.  PubMed DOI:10.1074/jbc.M306194200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]