DCX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DCX
Protein DCX PDB 1mjd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DCX, DBCN, DC, LISX, SCLH, XLIS, doublecortin
Зовнішні ІД OMIM: 300121 MGI: 1277171 HomoloGene: 7683 GeneCards: DCX
Шаблон експресії
PBB GE DCX 204850 s at fs.png

PBB GE DCX 204851 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001110222
NM_001110223
NM_001110224
NM_010025
RefSeq (білок)
NP_001103692
NP_001103693
NP_001103694
NP_034155
Локус (UCSC) Хр. X: 111.29 – 111.41 Mb Хр. X: 143.86 – 143.93 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DCX (англ. Doublecortin) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 365 амінокислот, а молекулярна маса — 40 574[4].

Послідовність амінокислот
1020304050
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEK
KAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQG
VRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV
KTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLN
KKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFI
ACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGP
MRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY
LPLSLDDSDSLGDSM

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як диференціація клітин, нейрогенез, альтернативний сплайсинг. Локалізований у цитоплазмі, клітинних відростках.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Slepak T.I., Salay L.D., Lemmon V.P., Bixby J.L. (2012). Dyrk kinases regulate phosphorylation of doublecortin, cytoskeletal organization, and neuronal morphology.. Cytoskeleton 69: 514 — 527.  PubMed DOI:10.1002/cm.21021
  • Sakamoto M., Ono J., Okada S., Nakamura Y., Kurahashi H. (2000). Genetic alteration of the DCX gene in Japanese patients with subcortical laminar heterotopia or isolated lissencephaly sequence.. J. Hum. Genet. 45: 167 — 170.  PubMed DOI:10.1007/s100380050204

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2714 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O43602 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]