DNM1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DNM1
Protein DNM1 PDB 1dyn.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DNM1, Dynamin-1, DNM, EIEE31, dynamin 1
Зовнішні ІД OMIM: 602377 MGI: 107384 HomoloGene: 123905 GeneCards: DNM1
Пов'язані генетичні захворювання
Синдром порушення активності та уваги[1]
Шаблон експресії
PBB GE DNM1 215116 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001301737
NM_010065
NM_001368679
RefSeq (білок)
NP_001005336
NP_001275666
NP_001275667
NP_001275668
NP_004399
NP_001288666
NP_034195
NP_001355608
Локус (UCSC) Хр. 9: 128.19 – 128.26 Mb Хр. 2: 32.31 – 32.35 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DNM1 (англ. Dynamin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 864 амінокислот, а молекулярна маса — 97 408[5].

Послідовність амінокислот
1020304050
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLEN
FVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLE
IEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPP
DIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRT
IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITA
ALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ
IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRT
GLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYP
RLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQ
QRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENL
SWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHS
MDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSE
LLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTV
STPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAP
GPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQA
SPSRPESPRPPFDL

Кодований геном білок за функціями належить до білкових моторів, гідролаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ендоцитоз, альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • van der Bliek A.M., Redelmeier T.E., Tisdale E.J., Meyerowitz E.M., Schmid S.L. (1993). Mutations in human dynamin block an intermediate stage in coated vesicle formation.. J. Cell Biol. 122: 553 — 563.  PubMed DOI:10.1083/jcb.122.3.553
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Soulet F., Yarar D., Leonard M., Schmid S.L. (2005). SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.. Mol. Biol. Cell 16: 2058 — 2067.  PubMed DOI:10.1091/mbc.E04-11-1016
  • Krendel M., Osterweil E.K., Mooseker M.S. (2007). Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.. FEBS Lett. 581: 644 — 650.  PubMed DOI:10.1016/j.febslet.2007.01.021
  • Li D., Dammer E.B., Lucki N.C., Sewer M.B. (2013). cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.. Mol. Biol. Cell 24: 848 — 857.  PubMed DOI:10.1091/mbc.E12-08-0597
  • Large-scale discovery of novel genetic causes of developmental disorders.. Nature 519: 223 — 228. 2015.  PubMed DOI:10.1038/nature14135

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]