DYNC1I1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DYNC1I1
Ідентифікатори
Символи DYNC1I1, dynein, cytoplasmic 1, intermediate chain 1, DNCI1, DNCIC1, dynein cytoplasmic 1 intermediate chain 1
Зовнішні ІД OMIM: 603772 MGI: 107743 HomoloGene: 68398 GeneCards: DYNC1I1
Пов'язані генетичні захворювання
Ожиріння, натуральна віспа[1]
Шаблон експресії
PBB GE DYNC1I1 205348 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001135556
NM_001135557
NM_001278421
NM_001278422
NM_004411
NM_001191023
NM_001191025
NM_001191026
NM_001191027
NM_010063
RefSeq (білок)
NP_001129028
NP_001129029
NP_001265350
NP_001265351
NP_004402
NP_001177952
NP_001177954
NP_001177955
NP_001177956
NP_034193
Локус (UCSC) Хр. 7: 95.77 – 96.11 Mb Хр. 6: 5.73 – 6.03 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DYNC1I1 (англ. Dynein cytoplasmic 1 intermediate chain 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 645 амінокислот, а молекулярна маса — 72 955[5].

Послідовність амінокислот
1020304050
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDS
DLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSS
KSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGV
SKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELE
NQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSD
IFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFAR
FHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGT
QNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTG
DVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPID
FSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFAC
VDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, хромосомах, центромерах, кінетохорі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sivaram M.V., Wadzinski T.L., Redick S.D., Manna T., Doxsey S.J. (2009). Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint.. EMBO J. 28: 902 — 914.  PubMed DOI:10.1038/emboj.2009.38
  • Merino-Gracia J., Zamora-Carreras H., Bruix M., Rodriguez-Crespo I. (2016). Molecular basis for the protein recognition specificity of the dynein light chain DYNLT1/Tctex1: characterization of the interaction with activin receptor IIB.. J. Biol. Chem. 291: 20962 — 20975.  PubMed DOI:10.1074/jbc.M116.736884

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]