DYNC1I2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DYNC1I2
Protein DYNC1I2 PDB 2pg1.png
Ідентифікатори
Символи DYNC1I2, DNCI2, IC2, DIC74, dynein cytoplasmic 1 intermediate chain 2, NEDMIBA
Зовнішні ІД OMIM: 603331 HomoloGene: 133934 GeneCards: DYNC1I2
Шаблон експресії
PBB GE DYNC1I2 211684 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
RefSeq (білок)
н/д
Локус (UCSC) Хр. 2: 171.69 – 171.75 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

DYNC1I2 (англ. Dynein cytoplasmic 1 intermediate chain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 638 амінокислот, а молекулярна маса — 71 457[3].

Послідовність амінокислот
1020304050
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEE
SDLEKKRREAEALLQSMGLTPESPIVFSEYWVPPPMSPSSKSVSTPSEAG
SQDSGDGAVGSRTLHWDTDPSVLQLHSDSDLGRGPIKLGMAKITQVDFPP
REIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEEND
SKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGR
DLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYN
NNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVG
GTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLIS
ISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVG
SEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTS
SFDWTVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALFACVDGMGRLD
LWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVG
EQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транспорт, ацетиляція, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Vaughan K.T., Vallee R.B. (1995). Cytoplasmic dynein binds dynactin through a direct interaction between the intermediate chains and p150Glued.. J. Cell Biol. 131: 1507 — 1516.  PubMed DOI:10.1083/jcb.131.6.1507
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Merino-Gracia J., Zamora-Carreras H., Bruix M., Rodriguez-Crespo I. (2016). Molecular basis for the protein recognition specificity of the dynein light chain DYNLT1/Tctex1: characterization of the interaction with activin receptor IIB.. J. Biol. Chem. 291: 20962 — 20975.  PubMed DOI:10.1074/jbc.M116.736884

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:2964 (англ.). Процитовано 28 серпня 2017. 
  3. UniProt, Q13409 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]