EGR1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EGR1
Zinc finger DNA complex.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EGR1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225, early growth response 1
Зовнішні ІД OMIM: 128990 MGI: 95295 HomoloGene: 56394 GeneCards: EGR1
Шаблон експресії
PBB GE EGR1 201694 s at fs.png

PBB GE EGR1 201693 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001964
NM_007913
RefSeq (білок)
NP_001955
NP_031939
Локус (UCSC) Хр. 5: 138.47 – 138.47 Mb Хр. 18: 34.86 – 34.86 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EGR1 (англ. Early growth response 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 543 амінокислот, а молекулярна маса — 57 507[4].

Послідовність амінокислот
1020304050
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLG
AAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHL
TAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLW
PEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSS
PIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVP
MIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFS
RSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDI
CGRKFARSDERKRHTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSY
PSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYS
SVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P. (1990). cDNA sequence of the human cellular early growth response gene Egr-1.. Nucleic Acids Res. 18: 4283 — 4283.  PubMed DOI:10.1093/nar/18.14.4283
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cullen E.M., Brazil J.C., O'Connor C.M. (2010). Mature human neutrophils constitutively express the transcription factor EGR-1.. Mol. Immunol. 47: 1701 — 1709.  PubMed DOI:10.1016/j.molimm.2010.03.003
  • Zandarashvili L., White M.A., Esadze A., Iwahara J. (2015). Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1.. FEBS Lett. 589: 1748 — 1753.  PubMed DOI:10.1016/j.febslet.2015.05.022

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3238 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P18146 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]