EGR2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EGR2
Protein EGR2 PDB 1a1i.png
Ідентифікатори
Символи EGR2, AT591, CMT1D, CMT4E, KROX20, early growth response 2, CHN1
Зовнішні ІД OMIM: 129010 MGI: 95296 HomoloGene: 20123 GeneCards: EGR2
Пов'язані генетичні захворювання
Charcot-Marie-Tooth disease type 4E, Charcot-Marie-Tooth disease type 1D[1]
Шаблон експресії
PBB GE EGR2 205249 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000399
NM_001136177
NM_001136178
NM_001136179
NM_001321037
NM_010118
NM_001347458
RefSeq (білок)
NP_000390
NP_001129649
NP_001129650
NP_001129651
NP_001307966
Локус (UCSC) Хр. 10: 62.81 – 62.92 Mb Хр. 10: 67.54 – 67.54 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EGR2 (англ. Early growth response 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 476 амінокислот, а молекулярна маса — 50 302[5].

Послідовність амінокислот
1020304050
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQ
MNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDP
QYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLG
VCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSL
AYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFP
CPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA
AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFAC
DYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPG
GTLCSSNSSSLGGGPLAPCSSRTRTP

Кодований геном білок за функціями належить до лігаз, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rangnekar V.M., Aplin A.C., Sukhatme V.P. (1990). The serum and TPA responsive promoter and intron-exon structure of EGR2, a human early growth response gene encoding a zinc finger protein.. Nucleic Acids Res. 18: 2749 — 2757.  PubMed DOI:10.1093/nar/18.9.2749
  • Luciano R.L., Wilson A.C. (2003). HCF-1 functions as a coactivator for the zinc finger protein Krox20.. J. Biol. Chem. 278: 51116 — 51124.  PubMed DOI:10.1074/jbc.M303470200
  • Garcia-Gutierrez P., Juarez-Vicente F., Gallardo-Chamizo F., Charnay P., Garcia-Dominguez M. (2011). The transcription factor Krox20 is an E3 ligase that sumoylates its Nab coregulators.. EMBO Rep. 12: 1018 — 1023.  PubMed DOI:10.1038/embor.2011.152

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]