EGR4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EGR4
Ідентифікатори
Символи EGR4, NGFI-C, NGFIC, PAT133, early growth response 4, Early growth response protein 4, AT133
Зовнішні ІД OMIM: 128992 MGI: 99252 HomoloGene: 1485 GeneCards: EGR4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001965
NM_020596
RefSeq (білок)
NP_001956
NP_065621
Локус (UCSC) Хр. 2: 73.29 – 73.29 Mb Хр. 6: 85.51 – 85.51 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EGR4 (англ. Early growth response 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 589 амінокислот, а молекулярна маса — 61 623[4].

Послідовність амінокислот
1020304050
MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPR
LPDSFPRGECPKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSR
RRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDAPAATGYPGAG
DFLSWALNSCGASGDLADSCFLEGPAPTPPPGLSYSGSFFIQAVPEHPHD
PEALFNLMSGILGLAPFPGPEAAASRSPLDAPFPAGSDALLPGPPDLYSP
DLGAAPFPEAFWEASPCAGAPSQCLYEPQLSPPDVKPGLRAPPASPALDA
VSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSIS
CPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSS
GDGGEFLASTQPQLSPLGLRSAAAADFPKPLVADIPGSSGVAAPPVPPPP
PTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESCVRSFARSDEL
NRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRF
ARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Holst C., Skerka C., Lichter P., Bialonski A., Zipfel P.F. (1993). Genomic organization, chromosomal localization and promoter function of the human zinc-finger gene pAT133.. Hum. Mol. Genet. 2: 367 — 372.  PubMed DOI:10.1093/hmg/2.4.367
  • Mueller H.-J., Skerka C., Bialonski A., Zipfel P.F. (1991). Clone pAT133 identifies a gene that encodes another human member of a class of growth factor-induced genes with almost identical zinc-finger domains.. Proc. Natl. Acad. Sci. U.S.A. 88: 10079 — 10083.  PubMed DOI:10.1073/pnas.88.22.10079

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3241 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q05215 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]