ELF5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ELF5
Protein ELF5 PDB 1wwx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ELF5, ESE2, E74 like ETS transcription factor 5
Зовнішні ІД OMIM: 605169 HomoloGene: 7702 GeneCards: ELF5
Шаблон експресії
PBB GE ELF5 220625 s at fs.png

PBB GE ELF5 220624 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_198381
NM_001243080
NM_001243081
NM_001422
XM_003752227
XM_008773909
XM_008773910
RefSeq (білок)
NP_001230009
NP_001230010
NP_001413
NP_938195
XP_003752275
XP_008772132
Локус (UCSC) Хр. 11: 34.48 – 34.51 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELF5 (англ. E74 like ETS transcription factor 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 265 амінокислот, а молекулярна маса — 31 263[4].

Послідовність амінокислот
1020304050
MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQT
ACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLC
SMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSN
CLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQ
GIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLV
YKFGKNAHGWQEDKL

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3320 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q9UKW6 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]