ERCC4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ERCC4
Protein ERCC4 PDB 1z00.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ERCC4, ERCC11, FANCQ, RAD1, XPF, XFEPS, excision repair cross-complementation group 4, ERCC excision repair 4, endonuclease catalytic subunit
Зовнішні ІД MGI: 1354163 HomoloGene: 3836 GeneCards: ERCC4
Пов'язані генетичні захворювання
conduct disorder[1]
Шаблон експресії
PBB GE ERCC4 210158 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005236
NM_015769
RefSeq (білок)
NP_005227
NP_056584
Локус (UCSC) Хр. 16: 13.92 – 13.95 Mb Хр. 16: 13.11 – 13.15 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ERCC4 (англ. ERCC excision repair 4, endonuclease catalytic subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 916 амінокислот, а молекулярна маса — 104 486[5].

Послідовність амінокислот
1020304050
MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQ
LHCHPACLVLVLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEV
YTQGGVIFATSRILVVDFLTDRIPSDLITGILVYRAHRIIESCQEAFILR
LFRQKNKRGFIKAFTDNAVAFDTGFCHVERVMRNLFVRKLYLWPRFHVAV
NSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKELKCHNPSLEVE
DLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ
YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAK
MSKKEKISEKMEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEA
LGGPGQVLICASDDRTCSQLRDYITLGAEAFLLRLYRKTFEKDSKAEEVW
MKFRKEDSSKRIRKSHKRPKDPQNKERASTKERTLKKKKRKLTLTQMVGK
PEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSSDAAFGILKEP
LTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG
KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRD
ETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH
RRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSR
YYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRI
LWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQD
FLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF
IHTSFAEVVSKGKGKK

Кодований геном білок за функціями належить до гідролаз, нуклеаз, ендонуклеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК, іоном магнію. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cleaver J.E., Thompson L.H., Richardson A.S., States J.C. (1999). A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.. Hum. Mutat. 14: 9 — 22.  PubMed DOI:10.1002/(SICI)1098-1004(1999)14:1<9::AID-HUMU2>3.0.CO;2-6
  • Tsodikov O.V., Enzlin J.H., Scharer O.D., Ellenberger T. (2005). Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.. Proc. Natl. Acad. Sci. U.S.A. 102: 11236 — 11241.  PubMed DOI:10.1073/pnas.0504341102
  • Matsumura Y., Nishigori C., Yagi T., Imamura S., Takebe H. (1998). Characterization of molecular defects in Xeroderma pigmentosum group F in relation to its clinically mild symptoms.. Hum. Mol. Genet. 7: 969 — 974.  PubMed DOI:10.1093/hmg/7.6.969
  • Fan F., Liu C., Tavare S., Arnheim N. (1999). Polymorphisms in the human DNA repair gene XPF.. Mutat. Res. 406: 115 — 120.  PubMed DOI:10.1016/S1383-5726(99)00008-4
  • Shen M.R., Jones I.M., Mohrenweiser H. (1998). Nonconservative amino acid substitution variants exist at polymorphic frequency in DNA repair genes in healthy humans.. Cancer Res. 58: 604 — 608.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]