F2RL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
F2RL1
Ідентифікатори
Символи F2RL1, GPR11, PAR2, Protease activated receptor 2, F2R like trypsin receptor 1
Зовнішні ІД MGI: 101910 HomoloGene: 21087 GeneCards: F2RL1
Шаблон експресії
PBB GE F2RL1 213506 at fs.png

PBB GE F2RL1 206429 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005242
NM_007974
RefSeq (білок)
NP_005233
NP_032000
Локус (UCSC) Хр. 5: 76.82 – 76.84 Mb Хр. 13: 95.51 – 95.53 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

F2RL1 (англ. F2R like trypsin receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 397 амінокислот, а молекулярна маса — 44 126[4].

Послідовність амінокислот
1020304050
MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTG
KGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVF
LFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNV
LIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWL
LILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGV
FLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD
FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, запальна відповідь, поліморфізм. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Nystedt S., Emilsson K., Larsson A.-K., Stroembeck B., Sundelin J. (1995). Molecular cloning and functional expression of the gene encoding the human proteinase-activated receptor 2.. Eur. J. Biochem. 232: 84 — 89.  PubMed DOI:10.1111/j.1432-1033.1995.tb20784.x
  • Luo W., Wang Y., Hanck T., Stricker R., Reiser G. (2006). Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1.. J. Biol. Chem. 281: 7927 — 7936.  PubMed DOI:10.1074/jbc.M510784200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Camerer E., Huang W., Coughlin S.R. (2000). Tissue factor- and factor X-dependent activation of protease-activated receptor 2 by factor VIIa.. Proc. Natl. Acad. Sci. U.S.A. 97: 5255 — 5260.  PubMed DOI:10.1073/pnas.97.10.5255
  • Sun G., Stacey M.A., Schmidt M., Mori L., Mattoli S. (2001). Interaction of mite allergens Der p3 and Der p9 with protease-activated receptor-2 expressed by lung epithelial cells.. J. Immunol. 167: 1014 — 1021.  PubMed DOI:10.4049/jimmunol.167.2.1014
  • Miike S., McWilliam A.S., Kita H. (2001). Trypsin induces activation and inflammatory mediator release from human eosinophils through protease-activated receptor-2.. J. Immunol. 167: 6615 — 6622.  PubMed DOI:10.4049/jimmunol.167.11.6615

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3538 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P55085 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]