FHL3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FHL3
Protein FHL3 PDB 1wyh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FHL3, SLIM2, four and a half LIM domains 3
Зовнішні ІД OMIM: 602790 MGI: 1341092 HomoloGene: 37928 GeneCards: FHL3
Шаблон експресії
PBB GE FHL3 218818 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004468
NM_001243878
NM_010213
RefSeq (білок)
NP_001230807
NP_004459
NP_001230807.1
NP_034343
Локус (UCSC) Хр. 1: 38 – 38.01 Mb Хр. 4: 124.7 – 124.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FHL3 (англ. Four and a half LIM domains 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 280 амінокислот, а молекулярна маса — 31 192[4].

Послідовність амінокислот
1020304050
MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHD
SRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQ
CSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYC
VPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQF
TSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFS
CARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Задіяний у такому біологічному процесі як ацетиляція. Білок має сайт для зв'язування з іонами металів, іоном цинку.

Література[ред. | ред. код]

  • Morgan M.J., Madgwick A.J.A. (1999). The LIM proteins FHL1 and FHL3 are expressed differently in skeletal muscle.. Biochem. Biophys. Res. Commun. 255: 245 — 250.  PubMed DOI:10.1006/bbrc.1999.0179
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Morgan M.J., Madgwick A.J.A. (1996). Slim defines a novel family of LIM-proteins expressed in skeletal muscle.. Biochem. Biophys. Res. Commun. 225: 632 — 638.  PubMed DOI:10.1006/bbrc.1996.1222

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3704 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q13643 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]