FLG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FLG
Ідентифікатори
Символи filaggrinepidermal filaggrinFLG
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FLG — ген, що кодує білок профілагрин , який є попередником філагрину, і розташований у людей на короткому плечі 1-ї хромосоми і складається з 3 екзонів.[1] Довжина поліпептидного ланцюга кодованого геном білка становить 4 061 амінокислот, а молекулярна маса — 435 170[2].

Послідовність амінокислот
1020304050
MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDD
PDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYESTRKENLPISGHK
HRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGRSKSPRETGGK
RHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTENTRLGDNRKRL
SERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSL
LEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESRTRKRRGSRVSQD
RDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSA
DSSRQSGTRHAETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSAT
GRGQASSAVSDRGHRGSSGSQASDSEGHSENSDTQSVSGHGKAGLRQQSH
QESTRGRSGERSGRSGSSLYQVSTHEQPDSAHGRTGTSTGGRQGSHHEQA
RDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSGHSGSHHSHTT
SQGRSDASHGQSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRH
SQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAQ
EQSRDGSRHPRSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQA
RSSAGERHGSRHQLQSADSSRHSGTGHGQASSAVRDSGHRGSSGSQATDS
EGHSEDSDTQSVSGHGQAGHHQQSHQESARDRSGERSRRSGSFLYQVSTH
KQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDTIRGHPGSSRR
GRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEE
QSRDGSRHSGSRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDS
DSEGHSEDSERWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSAD
SSRQSGTPHAETSSGGQAASSHEQARSSPGERHGSRHQQSADSSRHSGIP
RRQASSAVRDSGHWGSSGSQASDSEGHSEESDTQSVSGHGQDGPHQQSHQ
ESARDWSGGRSGRSGSFIYQVSTHEQSESAHGRTRTSTGRRQGSHHEQAR
DSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGHSGSHHSHTTS
QGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHS
QVGQEQSSGSRTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSRE
QSRDGSRHPGFHQEDRASHGHSADSSRQSGTHHTESSSHGQAVSSHEQAR
SSPGERHGSRHQQSADSSRHSGIGHRQASSAVRDSGHRGSSGSQVTNSEG
HSEDSDTQSVSAHGQAGPHQQSHKESARGQSGESSGRSRSFLYQVSSHEQ
SESTHGQTAPSTGGRQGSRHEQARNSSRHSASQDGQDTIRGHPGSSRGGR
QGSYHEQSVDRSGHSGYHHSHTTPQGRSDASHGQSGPRSASRQTRNEEQS
GDGSRHSGSRHHEPSTRAGSSRHSQVGQGESAGSKTSRRQGSSVSQDRDS
EGHSEDSERRSESASRNHYGSAREQSRHGSRNPRSHQEDRASHGHSAESS
RQSGTRHAETSSGGQAASSQEQARSSPGERHGSRHQQSADSSTDSGTGRR
QDSSVVGDSGNRGSSGSQASDSEGHSEESDTQSVSAHGQAGPHQQSHQES
TRGQSGERSGRSGSFLYQVSTHEQSESAHGRTGPSTGGRQRSRHEQARDS
SRHSASQEGQDTIRGHPGSSRGGRQGSHYEQSVDSSGHSGSHHSHTTSQE
RSDVSRGQSGSRSVSRQTRNEKQSGDGSRHSGSRHHEASSRADSSRHSQV
GQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHLGSAWEQS
RDGSRHPGSHHEDRAGHGHSADSSRQSGTRHTESSSRGQAASSHEQARSS
AGERHGSHHQLQSADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDSEGH
SEDSDTQSVSAQGKAGPHQQSHKESARGQSGESSGRSGSFLYQVSTHEQS
ESTHGQSAPSTGGRQGSHYDQAQDSSRHSASQEGQDTIRGHPGPSRGGRQ
GSHQEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRKTYDKEQSG
DGSRHSGSHHHEASSWADSSRHSLVGQGQSSGPRTSRPRGSSVSQDSDSE
GHSEDSERRSGSASRNHHGSAQEQSRDGSRHPRSHHEDRAGHGHSAESSR
QSGTHHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQ
ASSAVRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQEST
RGRSAGRSGRSGSFLYQVSTHEQSESAHGRTGTSTGGRQGSHHKQARDSS
RHSTSQEGQDTIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGR
SDASHGHSGSRSASRQTRNDEQSGDGSRHSGSRHHEASSRADSSGHSQVG
QGQSEGPRTSRNWGSSFSQDSDSQGHSEDSERWSGSASRNHHGSAQEQLR
DGSRHPRSHQEDRAGHGHSADSSRQSGTRHTQTSSGGQAASSHEQARSSA
GERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDNEGHSE
DSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSGSFLYQVSTHEQSES
SHGWTGPSTRGRQGSRHEQAQDSSRHSASQDGQDTIRGHPGSSRGGRQGY
HHEHSVDSSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSGDG
SRHSGSRHHEASTHADISRHSQAVQGQSEGSRRSRRQGSSVSQDSDSEGH
SEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSADSSRQS
GTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQAS
SAVRDSGHRGYSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARG
RSGETSGHSGSFLYQVSTHEQSESSHGWTGPSTRGRQGSRHEQAQDSSRH
SASQYGQDTIRGHPGSSRGGRQGYHHEHSVDSSGHSGSHHSHTTSQGRSD
ASRGQSGSRSASRTTRNEEQSGDSSRHSVSRHHEASTHADISRHSQAVQG
QSEGSRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHRGSVQEQSRHG
SRHPRSHHEDRAGHGHSADRSRQSGTRHAETSSGGQAASSHEQARSSPGE
RHGSRHQQSADSSRHSGIPRGQASSAVRDSRHWGSSGSQASDSEGHSEES
DTQSVSGHGQAGPHQQSHQESARDRSGGRSGRSGSFLYQVSTHEQSESAH
GRTRTSTGRRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRRGRQGSHY
EQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRQTRNDEQSGDGSR
HSWSHHHEASTQADSSRHSQSGQGQSAGPRTSRNQGSSVSQDSDSQGHSE
DSERWSGSASRNHRGSAQEQSRDGSRHPTSHHEDRAGHGHSAESSRQSGT
HHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSA
VRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQESTRGRS
AGRSGRSGSFLYQVSTHEQSESAHGRAGPSTGGRQGSRHEQARDSSRHSA
SQEGQDTIRGHPGSRRGGRQGSYHEQSVDRSGHSGSHHSHTTSQGRSDAS
HGQSGSRSASRETRNEEQSGDGSRHSGSRHHEASTQADSSRHSQSGQGES
AGSRRSRRQGSSVSQDSDSEAYPEDSERRSESASRNHHGSSREQSRDGSR
HPGSSHRDTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHSGIQSRGSP
HSSSSYHYQSEGTERQKGQSGLVWRHGSYGSADYDYGESGFRHSQHGSVS
YNSNPVVFKERSDICKASAFGKDHPRYYATYINKDPGLCGHSSDISKQLG
FSQSQRYYYYE

Білок філагрин та його попередник[ред. | ред. код]

Філагрин (похідне від англ. Filament aggregating protein) - структурний білок шкіри, який специфічно взаємодіє з проміжними филаментами - кератинами. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

Утворюється філаггрін з профілаггріна. Профілаггрін - великий (> 400 kDa) нерозчинний поліпротеїнів, який в результаті дефосфорилювания і розкладання утворює мономери філаггріна в роговому шарі шкіри[3]. Профілаггрін є основним компонентом кератогіалінових гранул, які видно в світловий мікроскоп в зернистому шарі епідермісу.

Мономерний філаггрін зв'язується з кератином 1 і 10 і іншими проміжними білками - філаментами кератинового цитоскелета, утворюючи тісні зв'язки між цими волокнами; таким чином, відбувається колапс і сплощення клітин на поверхні рогового шару з утворенням лусочок (у ссавців на кератинові волокна і зв'язуючий їх філагрін приходиться 80-90% загальної маси білка епідермісу).[4]

Філагрин має важливе значення для регуляції епідермального гомеостазу. У межах рогового шару, філагрінові мономери можуть бути включені в ліпідну оболонку, яка відповідає за бар'єрну функцію шкіри. Альтернативно, ці білки можуть взаємодіяти з кератиновими проміжними філаментами. Філагрін проходить подальшу обробку в верхньому роговому шарі, щоб вивільнити вільну амінокислоту, яка допомагає утримувати воду[4].

В остаточному підсумку філагрін у верхній частині рогового шару розпадається на окремі амінокислоти [5]. Філаггрін містить велику кількість гістидину, який метаболізується в транс-уроканіновую кислоту (транс-UCA) і пірролідон-5-карбонову кислоту (РСА); ці органічні кислоти допомагають підтримувати в епідермісі необхідне значення градієнта рН. Мутації з втратою функції в гені філаггріна (FLG) проявляються в порушенні бар'єрних функцій епідермісу, розвитку атопічного дерматиту і алергічної сенсибілізації.

Клінічне значення[ред. | ред. код]

Основна роль білка філагрина у підтримці бар'єру шкіри визначали з ідентифікацією мутацій, що втратили функцію, в генах профілагріна (FLG). Було показано, що ці мутації є причиною ichthyosis vulgaris і є основним фактором ризику розвитку атопічного дерматиту, астми, пов'язаної з атопічним дерматитом, а також системними алергіями. Мутації в гені FLG надзвичайно поширені, зустрічаються приблизно у 9% осіб з європейських популяцій. Відкриття цих широко поширених мутацій, як очікується, матиме великий вплив на класифікацію та лікування багатьох пацієнтів з іхтіозом та атопічними захворюваннями. Також є сподівання, що генетичне відкриття мутацій FLG призведе до подальшого розвитку більш специфічних, неіммуносупресивних методів лікування, здатних відновити ефективну функцію бар'єру шкіри та полегшити чи запобігти захворюванню у схильних осіб.[6]

Нещодавні дослідження людські генетичні настійно свідчать, що зменшення бар'єрних функцій шкіри внаслідок зменшення або повної втрати експресії філагріну призводить до посилення перкутанної передачі алергенів. Філагрин знаходиться на передній лінії захисту і захищає організм від входу зовнішніх речовин навколишнього середовища, які в іншому випадку можуть викликати аномальні імунні реакції.[7]

Було показано, що майже у 50% усіх важких випадків екземи може бути щонайменше один мутантний ген філагріну. R501X та 2284del4, як правило, не зустрічаються в не кавказьких індивідів, хоча нові явища (3321delA та S2554X), які дають подібні ефекти, були виявлені в японських популяціях[8]. Мутації укорочення R501X та 2284del4 є найпоширенішими мутаціями в кавказькій популяції, з 7-10% кавказького населення, що мають принаймні одну копію цих мутацій[9].

Дефект бар'єру, який спостерігається при нульових носіях філагрін, також, як видається, призводить до підвищеної сприйнятливості та загострень астми. [10][11][12] Дефіцит філагрину є одним з найвищих геномічних генетичних детермінант астми, поряд з виявленими варіантами, що регулюють експресію ORMDL3 [13].

Досліди на тваринах[ред. | ред. код]

Порівняльні геномічні дослідження показали, що структура ФЛГ однакова у людини, миші (Mus musculus) та собаці (Canis lupus familiaris). Проте кількість повних повторів та довжини повторень відрізняються між різновидами. Ці відмінності можна визнати як приклад структурних змін, що виникають внаслідок видоспецифічного дублювання. Структурні варіації є основним джерелом морфологічних відмінностей, які можуть дозволити індивідууму адаптуватися до нових середовищ і прискорювати появу розбіжностей між видами. Порівняння тісно пов'язані видів з коротким періодом розбіжності дозволяє нам краще зрозуміти механізми, що приводять до швидкої розбіжності.[14]

Досліди на приматах[ред. | ред. код]

Були проведені досліди на різних видах приматів для виявлення варіації повторюваної області ФЛГ серед п'яти видів приматів: довгохвоста макака (Macaca fascicularis), орангутан (Pongo abelii), горила західна (Gorilla gorilla), шимпанзе (Pan troglodytes) і людини.

У цьому дослідженні було порівняно узгоджені моделі народження та смерті, які часто використовуються для копій генів. Було виявленно, що існує високе нуклеотидне різноманіття між філагрінськими повторними областями, що відповідає моделі народження та смерті. Філогенетичні аналізи також показали, що незалежні події дублювання створювали повторювані послідовності в макаки двухвостої та орангутанів, тоді як було побачено різні випадки дублювання та втрати в повторах в горил, шимпанзе та людей. Порівняння повторюваних послідовностей, що виявляються, виділяють очищення в межах видів та специфічні дублікації роду за різними видами. Ми також виявили варіацію довжини повторюваного регіону в межах таких видів, як шимпанзе та довгохвоста макака.

Зроблено висновок, що варіація копії повторюваних послідовностей ФЛГ між приматами може бути наслідком видоспецифічної розбіжності та поширення.[14]

Досліди на собаках[ред. | ред. код]

Також були проведені експерименти на собаках. Аналіз послідовності геномних ДНК показав, що собачий ФЛГ містив чотири одиниці повторюваних послідовностей, що відповідають FLG - мономерному білку. Вестерн-блоти, зондовані з анти-собакою FLG-мономером, виявили два смуги на рівні 59 і 54 кДа, які були оцінені розмірами. Результати імуногістохімії показали, що собачий ФЛГ був виражений в гранульованому шарі епідермісу. Це дослідження показало унікальну генну структуру собачої ФЛГ, яка призводить до виробництва мономерів ФЛГ більших, ніж у людей або мишей. Антитіла проти собак ФЛГ, висунуті в цьому дослідженні, виявили ФЛГ у шкірі собак. Ці антитіла дозволять нам експортувати собак, дефіцитних ФЛГ, з собачим атопічним дерматитом або іхтіозом.[15]

Література[ред. | ред. код]

  • Thulin C.D., Walsh K.A. (1995). Identification of the amino terminus of human filaggrin using differential LC/MS techniques: implications for profilaggrin processing.. Biochemistry 34: 8687 — 8692.  PubMed DOI:10.1021/bi00027a018
  • Senshu T., Kan S., Ogawa H., Manabe M., Asaga H. (1996). Preferential deimination of keratin K1 and filaggrin during the terminal differentiation of human epidermis.. Biochem. Biophys. Res. Commun. 225: 712 — 719.  PubMed DOI:10.1006/bbrc.1996.1240
  • Wu Z., Hansmann B., Meyer-Hoffert U., Glaser R., Schroder J.M. (2009). Molecular identification and expression analysis of filaggrin-2, a member of the S100 fused-type protein family.. PLoS ONE 4: E5227 — E5227.  PubMed DOI:10.1371/journal.pone.0005227
  • Presland R.B., Haydock P.V., Fleckman P., Nirunsuksiri W., Dale B.A. (1992). Characterization of the human epidermal profilaggrin gene. Genomic organization and identification of an S-100-like calcium binding domain at the amino terminus.. J. Biol. Chem. 267: 23772 — 23781.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3748 (англ.). Процитовано 20 грудня 2016. 
  2. UniProt, P20930 (англ.). Процитовано 20 грудня 2016. 
  3. Ovaere, Petra; Lippens, Saskia; Vandenabeele, Peter; Declercq, Wim. The emerging roles of serine protease cascades in the epidermis. Trends in Biochemical Sciences 34 (9). с. 453–463. doi:10.1016/j.tibs.2009.08.001. Процитовано 2018-01-22. 
  4. а б Proksch, Ehrhardt; Brandner, Johanna M.; Jensen, Jens-Michael (2008-12-01). The skin: an indispensable barrier. Experimental Dermatology (en) 17 (12). с. 1063–1072. ISSN 1600-0625. doi:10.1111/j.1600-0625.2008.00786.x. Процитовано 2018-01-22. 
  5. Presland, R. B.; Haydock, P. V.; Fleckman, P.; Nirunsuksiri, W.; Dale, B. A. (1992-11-25). Characterization of the human epidermal profilaggrin gene. Genomic organization and identification of an S-100-like calcium binding domain at the amino terminus. The Journal of Biological Chemistry 267 (33). с. 23772–23781. ISSN 0021-9258. PMID 1429717. Процитовано 2018-01-22. 
  6. McGrath, John A (2008-05-01). Filaggrin and the great epidermal barrier grief. Australasian Journal of Dermatology (en) 49 (2). с. 67–74. ISSN 1440-0960. doi:10.1111/j.1440-0960.2008.00443.x. Процитовано 2018-01-22. 
  7. Sandilands, Aileen; Sutherland, Calum; Irvine, Alan D.; McLean, W. H. Irwin (2009-05-01). Filaggrin in the frontline: role in skin barrier function and disease. Journal of Cell Science 122 (9). с. 1285–1294. ISSN 0021-9533. PMC PMC2721001. PMID 19386895. doi:10.1242/jcs.033969. Процитовано 2018-01-22. 
  8. Nomura, Toshifumi; Sandilands, Aileen; Akiyama, Masashi; Liao, Haihui; Evans, Alan T.; Sakai, Kaori; Ota, Mitsuhito; Sugiura, Hisashi та ін. (February 2007). Unique mutations in the filaggrin gene in Japanese patients with ichthyosis vulgaris and atopic dermatitis. The Journal of Allergy and Clinical Immunology 119 (2). с. 434–440. ISSN 0091-6749. PMID 17291859. doi:10.1016/j.jaci.2006.12.646. Процитовано 2018-01-22. 
  9. Palmer, Colin N. A.; Irvine, Alan D.; Terron-Kwiatkowski, Ana; Zhao, Yiwei; Liao, Haihui; Lee, Simon P.; Goudie, David R.; Sandilands, Aileen та ін. (April 2006). Common loss-of-function variants of the epidermal barrier protein filaggrin are a major predisposing factor for atopic dermatitis. Nature Genetics 38 (4). с. 441–446. ISSN 1061-4036. PMID 16550169. doi:10.1038/ng1767. Процитовано 2018-01-22. 
  10. Basu, K.; Palmer, C. N. A.; Lipworth, B. J.; McLean, W. H. Irwin; Terron-Kwiatkowski, A.; Zhao, Y.; Liao, H.; Smith, F. J. D. та ін. (September 2008). Filaggrin null mutations are associated with increased asthma exacerbations in children and young adults. Allergy 63 (9). с. 1211–1217. ISSN 1398-9995. PMID 18307574. doi:10.1111/j.1398-9995.2008.01660.x. Процитовано 2018-01-22. 
  11. Palmer, Colin N. A.; Ismail, Tahmina; Lee, Simon P.; Terron-Kwiatkowski, Ana; Zhao, Yiwei; Liao, Haihui; Smith, Frances J. D.; McLean, W. H. Irwin та ін. (July 2007). Filaggrin null mutations are associated with increased asthma severity in children and young adults. The Journal of Allergy and Clinical Immunology 120 (1). с. 64–68. ISSN 0091-6749. PMID 17531295. doi:10.1016/j.jaci.2007.04.001. Процитовано 2018-01-22. 
  12. Henderson, John; Northstone, Kate; Lee, Simon P.; Liao, Haihui; Zhao, Yiwei; Pembrey, Marcus; Mukhopadhyay, Somnath; Smith, George Davey та ін. (April 2008). The burden of disease associated with filaggrin mutations: a population-based, longitudinal birth cohort study. The Journal of Allergy and Clinical Immunology 121 (4). с. 872–877.e9. ISSN 1097-6825. PMID 18325573. doi:10.1016/j.jaci.2008.01.026. Процитовано 2018-01-22. 
  13. Tavendale, Roger; Macgregor, Donald F.; Mukhopadhyay, Somnath; Palmer, Colin N. A. (April 2008). A polymorphism controlling ORMDL3 expression is associated with asthma that is poorly controlled by current medications. The Journal of Allergy and Clinical Immunology 121 (4). с. 860–863. ISSN 1097-6825. PMID 18395550. doi:10.1016/j.jaci.2008.01.015. Процитовано 2018-01-22. 
  14. а б Romero, Vanessa; Hosomichi, Kazuyoshi; Nakaoka, Hirofumi; Shibata, Hiroki; Inoue, Ituro (2017-01-11). Structure and evolution of the filaggrin gene repeated region in primates. BMC Evolutionary Biology 17. ISSN 1471-2148. PMC PMC5225520. PMID 28077068. doi:10.1186/s12862-016-0851-5. Процитовано 2018-01-22. 
  15. Kanda, Satoko; Sasaki, Takashi; Shiohama, Aiko; Nishifuji, Koji; Amagai, Masayuki; Iwasaki, Toshiroh; Kudoh, Jun (February 2013). Characterization of canine filaggrin: gene structure and protein expression in dog skin. Veterinary Dermatology 24 (1). с. 25–31.e7. ISSN 1365-3164. PMID 23331676. doi:10.1111/j.1365-3164.2012.01105.x. Процитовано 2018-01-22. 

Див. також[ред. | ред. код]