FOXC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXC1
Protein FOXC1 PDB 1d5v.png
Ідентифікатори
Символи FOXC1, ARA, FKHL7, FREAC-3, FREAC3, IGDA, IHG1, IRID1, RIEG3, forkhead box C1, ASGD3
Зовнішні ІД OMIM: 601090 MGI: 1347466 HomoloGene: 20373 GeneCards: FOXC1
Пов'язані генетичні захворювання
Axenfeld-Rieger syndrome type 3[1]
Шаблон експресії
PBB GE FOXC1 213260 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001453
NM_008592
RefSeq (білок)
NP_001444
NP_032618
Локус (UCSC) Хр. 6: 1.61 – 1.61 Mb Хр. 13: 31.81 – 31.81 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXC1 (англ. Forkhead box C1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 553 амінокислот, а молекулярна маса — 56 789[5].

Послідовність амінокислот
1020304050
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP
AHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKIT
LNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGS
YWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQ
PPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGS
AAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAP
PPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLAL
GAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAM
SLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGG
GGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQ
QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC
SKF

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Saleem R.A., Banerjee-Basu S., Berry F.B., Baxevanis A.D., Walter M.A. (2001). Analyses of the effects that disease-causing missense mutations have and function of the winged-helix protein FOXC1.. Am. J. Hum. Genet. 68: 627 — 641.  PubMed DOI:10.1086/318792
  • Saleem R.A., Banerjee-Basu S., Berry F.B., Baxevanis A.D., Walter M.A. (2003). Structural and functional analyses of disease-causing missense mutations in the forkhead domain of FOXC1.. Hum. Mol. Genet. 12: 2993 — 3005.  PubMed DOI:10.1093/hmg/ddg324
  • Saleem R.A., Murphy T.C., Liebmann J.M., Walter M.A. (2003). Identification and analysis of a novel mutation in the FOXC1 forkhead domain.. Invest. Ophthalmol. Vis. Sci. 44: 4608 — 4612.  PubMed DOI:10.1167/iovs.03-0090
  • Ito Y.A., Footz T.K., Murphy T.C., Courtens W., Walter M.A. (2007). Analyses of a novel L130F missense mutation in FOXC1.. Arch. Ophthalmol. 125: 128 — 135.  PubMed DOI:10.1001/archopht.125.1.128
  • Khan A.O., Aldahmesh M.A., Al-Amri A. (2008). Heterozygous FOXC1 mutation (M161K) associated with congenital glaucoma and aniridia in an infant and a milder phenotype in her mother.. Ophthalmic Genet. 29: 67 — 71.  PubMed DOI:10.1080/13816810801908152
  • Fetterman C.D., Mirzayans F., Walter M.A. (2009). Characterization of a novel FOXC1 mutation, P297S, identified in two individuals with anterior segment dysgenesis.. Clin. Genet. 76: 296 — 299.  PubMed DOI:10.1111/j.1399-0004.2009.01210.x

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]