FOXC2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXC2
PDB 1d5v EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXC2, FKHL14, LD, MFH-1, MFH1, forkhead box C2
Зовнішні ІД OMIM: 602402 MGI: 1347481 HomoloGene: 21091 GeneCards: FOXC2
Пов'язані генетичні захворювання
Lymphedema–distichiasis syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005251
NM_013519
RefSeq (білок)
NP_005242
NP_038547
Локус (UCSC) Хр. 16: 86.57 – 86.57 Mb Хр. 8: 121.12 – 121.12 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXC2 (англ. Forkhead box C2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 501 амінокислот, а молекулярна маса — 53 719[5].

Послідовність амінокислот
1020304050
MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSA
GMGRSYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQ
FIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDP
DSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHL
ADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAG
SPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPP
LALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCV
PPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAP
PPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNV
REMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
Y

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Miura N., Iida K., Kakinuma H., Yang X.-L., Sugiyama T. (1997). Isolation of the mouse (MFH-1) and human (FKHL 14) mesenchyme fork head-1 genes reveals conservation of their gene and protein structures.. Genomics 41: 489 — 492.  PubMed DOI:10.1006/geno.1997.4695
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • van Dongen M.J., Cederberg A., Carlsson P., Enerback S., Wikstrom M. (2000). Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11.. J. Mol. Biol. 296: 351 — 359.  PubMed DOI:10.1006/jmbi.1999.3476

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]