FOXP3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXP3
Ідентифікатори
Символи immunodeficiencypolyendocrinopathyenteropathyX-linkedscurfinFOXP3delta7FOXP3forkhead box protein P3immune dysregulationpolyendocrinopathyenteropathyX-linked
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE FOXP3 221333 at fs.png

PBB GE FOXP3 221334 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FOXP3 (англ. Forkhead box P3), також відомий як скурфін – білок, який кодується геном FOXP3, розташованим у людей на короткому плечі X-хромосоми.[1] Довжина поліпептидного ланцюга білка становить 431 амінокислот, а молекулярна маса — 47 244[2]. Бере участь у імунній відповіді. Член родини білків FOX, FOXP3, схоже, функціонує як головний регулятор (фактор транскрипції) в розвитку і функціонуванні регуляторних Т-клітин.[3] Регуляторні Т-клітини, як правило, знижують інтенсивність імунної відповіді. При раку, надлишкова регуляторна активність Т-клітин може стати на заваді імунній системі у руйнуванні ракових клітин. У автоімунних захворювань, дефіцит регуляторної активності Т-клітин може дозволити іншим автоімунним клітинам атакувати тканини організму.

Допоки точні механізми контролю ще не винайдено, FOX-білки відносять до forkhead/winged-helix родини транскрипційних регуляторів, що, як передбачається, здійснюють контроль через зв'язуючі взаємодії під час транскрипції подібних ДНК. У регуляторних Т-клітинах модельних систем фактор транскрипції FOXP3 займає промотори генів, що беруть участь в регулюванні функції Т-клітин, і може пригнічувати транскрипцію ключових генів після стимуляції Т-клітинних рецепторів. [4]

Послідовність амінокислот
1020304050
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDL
RGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRP
HFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLP
PGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCK
WPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEK
EKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI
LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVES
EKGAVWTVDELEFRKKRSQRPSRCSNPTPGP

Цей білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Структура[ред. | ред. код]

Людські FOXP3 гени містять 11 кодуючих екзонів. Екзон-інтронні межі ідентичні по кодуючих регіонах мишачих і людських генів. У результаті аналізу геномної послідовності, ген FOXP3 приєднується до р-плеча Х-хромосоми (зокрема, Xp11.23). [5][6]

Фізіологія[ред. | ред. код]

Відкриття Foxp3 як специфічного маркера природних Т-регуляторних клітин (nTregs родини Т-клітин) і адаптивних / індукованих Т-регуляторних клітин (A / iTregs) дав молекулярний якір до популяції регуляторних Т-клітин (Tregs), що раніше визначалися неспецифічними маркерами, такими як CD25 або CD45RB. [7][8][9]

У дослідженнях на тваринах, Tregs, які експресують Foxp3 важливі в передачі імунної толерантності, особливо аутотолерантності. Індукція або введення Foxp3 позитивних Т-клітин в дослідженнях на тварин призвела до помітного скорочення у тяжкості (автоімунного) захворювання в моделях діабету, розсіяного склерозу, астми, запального захворювання кишечника, тиреоїдиту і ниркових захворювань.[10] Випробування на людях продемонстрували слабші результати.

На жаль, останні дослідження Т-клітинної біології показали, що Т-клітинна природа більш пластична, ніж спочатку передбачалося. Таким чином, регуляторна Т-клітинна терапія може бути ризикована, тому що регуляторні Т-клітини, що передаються пацієнту можуть змінитись і стати прозапальними Т-клітинами[11][12]. Т-helper 17 (Th17) клітини є прозапальними і виробляються в аналогічних умовах, як і а/iTregs. Th17 клітини виробляються під впливом TGF-β і IL-6 (або IL- 21), в той час як а/iTregs виробляються під впливом виключно TGF-β, таким чином, різниця між прозапальними і про-регуляторними сценаріями є наявність одного інтерлейкіну. В імунологічних лабораторіях обговорюється яку з IL-6 або IL-21 слід обрати як визначальну сигнальну молекулу. Дослідження на мишах вказують на IL-6, тоді як досліди на людях вказують на IL-21.

Патофізіологія[ред. | ред. код]

У хворобах людини, зміни в чисельності регуляторних Т-клітин — і, зокрема, тих, які відповідають за експресію Foxp3 — зустрічаються в ряді хворобливих станів. Наприклад, пацієнти з пухлинами мають локальний відносний надлишок Foxp3 позитивних Т-клітин, який інгібує здатність організму пригнічувати утворення ракових клітин.[13] З іншого боку, пацієнти з автоімунними захворюваннями, такими як системний червоний вовчак (Хвороба Лібмана-Сакса) мають пов'язану дисфункцію Foxp3 позитивних клітин.[14] Ген Foxp3 також мутував у зчепленим зі статтю успадкуванням синдромом IPEX (Immunodysregulation, Polyendocrinopathy, та Enteropathy, X-linked).[15] Ці мутації були в forkhead області FOXP3, вказуючи, що мутації можуть порушити критичні взаємодії ДНК.

У мишей, Foxp3 мутації (мутації рамки зчитування, що призводять до нестачі forkhead області у білка) несуть відповідальність за «покритий нальотом», зчепленим зі статтю успадкуванням рецесивного мутанту миші, що призводить до летальності в гемізіготних чоловіків від 16 до 25 днів після народження.[6] Ці миші мають перепроліферацію CD4+ Т-лімфоцитів, обширне багатоорганне проникнення, і збільшення кількості цитокінів. Цей фенотип схожий на ті, які позбавлені експресії CTLA-4, TGF-β, захворювання людини IPEX або видалення гена у мишей Foxp3 («покритий лупою мишей»). Патологія спостерігається в покритих нальотом мишей, здається, в результаті нездатності правильно регулювати діяльність CD4+ Т-клітин. У мишей з гіперекспресією гена FOXP3, спостерігається менше Т-клітин . Решта Т-клітини мають погану проліферативну і цитолітичну відповіді і погане виробництво інтерлейкіну-2, хоча розвиток тимуса відбувається нормально. Гістологічний аналіз показує, що у периферійних лімфоїдних органах, особливо у лімфатичних вузлів, відсутня належна кількість клітин.

Роль в онкологічних захворюваннях[ред. | ред. код]

На додаток до ролі FOXP3 в регулюючій диференціації Т-клітин, декілька робіт довели, що FoxP3 відіграє важливу роль у розвитку раку.

Понижувальну регуляцію експресії Foxp3 було помічено в зразках, отриманих з пухлин молочної залози, передміхурової залози, і хворих раком яєчників, що свідчить що FoxP3 є потенційним геном-супресором пухлин. Експресія FoxP3 була також виявлена у зразках, отриманих з пухлин додаткових типів раку, в тому числі підшлункової залози, меланоми, печінки, сечового міхура, щитовидної залози, раку шийки матки. Тим не менше, в цих доповідях, відповідні нормальні тканини не були проаналізовані, тому залишається неясним, чи є це FoxP3 про- чи анти-пухлиноутворююча молекула в цих пухлинах.

Дві роботи рішуче показують, що FoxP3 служить, як пригнічувальний пухлину фактор транскрипції в розвитку раку. По-перше, FoxP3 пригнічує експресію HER2, SKP2, SATB1 і MYC онкогенів і індукує експресію генів-супресорів пухлинного P21 і LATS2 в грудях і раку передміхурової залози. По-друге, надлишкова експресія FoxP3 в меланомі,[16] гліоми, молочної залози, передміхурової залози і раку яєчників клітинних ліній викликає глибоке інгібіторне зростання ефектів в пробірці і в природних умовах. Тим не менш, ця гіпотеза потребує подальшого розгляду в майбутніх дослідженнях.

Див. також[ред. | ред. код]

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6106 (англ.). Процитовано 12 лютого 2018. 
  2. UniProt, Q9BZS1 (англ.). Процитовано 12 лютого 2018. 
  3. Zhang L, Zhao Y (June 2007). The regulation of Foxp3 expression in regulatory CD4(+)CD25(+)T cells: multiple pathways on the road. J. Cell. Physiol. 211 (3): 590–597. PMID 17311282. doi:10.1002/jcp.21001. 
  4. Marson A, Kretschmer K, Frampton GM, Jacobsen ES, Polansky JK, MacIsaac KD, Levine SS, Fraenkel E, von Boehmer H, Young RA (February 2007). Foxp3 occupancy and regulation of key target genes during T-cell stimulation. Nature 445 (7130): 931–5. PMC 3008159. PMID 17237765. doi:10.1038/nature05478. 
  5. Bennett CL, Yoshioka R, Kiyosawa H, Barker DF, Fain PR, Shigeoka AO, Chance PF (February 2000). X-Linked syndrome of polyendocrinopathy, immune dysfunction, and diarrhea maps to Xp11.23-Xq13.3. Am. J. Hum. Genet. 66 (2): 461–468. PMC 1288099. PMID 10677306. doi:10.1086/302761. 
  6. а б Brunkow ME, Jeffery EW, Hjerrild KA, Paeper B, Clark LB, Yasayko SA, Wilkinson JE, Galas D, Ziegler SF, Ramsdell F (January 2001). Disruption of a new forkhead/winged-helix protein, scurfin, results in the fatal lymphoproliferative disorder of the scurfy mouse. Nat. Genet. 27 (1): 68–73. PMID 11138001. doi:10.1038/83784. 
  7. Hori S, Nomura T, Sakaguchi S (February 2003). Control of regulatory T cell development by the transcription factor Foxp3. Science 299 (5609): 1057–61. PMID 12522256. doi:10.1126/science.1079490. 
  8. Fontenot JD, Gavin MA, Rudensky AY (April 2003). Foxp3 programs the development and function of CD4+CD25+ regulatory T cells. Nat. Immunol. 4 (4): 330–6. PMID 12612578. doi:10.1038/ni904. 
  9. Fontenot JD, Rasmussen JP, Williams LM, Dooley JL, Farr AG, Rudensky AY (March 2005). Regulatory T cell lineage specification by the forkhead transcription factor foxp3. Immunity 22 (3): 329–41. PMID 15780990. doi:10.1016/j.immuni.2005.01.016. 
  10. Suri-Payer E, Fritzsching B (August 2006). Regulatory T cells in experimental autoimmune disease. Springer Semin. Immunopathol. 28 (1): 3–16. PMID 16838180. doi:10.1007/s00281-006-0021-8. 
  11. Romagnani
  12. Stockinger
  13. Beyer M, Schultze JL (August 2006). Regulatory T cells in cancer. Blood 108 (3): 804–11. PMID 16861339. doi:10.1182/blood-2006-02-002774. 
  14. Alvarado-Sánchez B, Hernández-Castro B, Portales-Pérez D, Baranda L, Layseca-Espinosa E, Abud-Mendoza C, Cubillas-Tejeda AC, González-Amaro R (September 2006). Regulatory T cells in patients with systemic lupus erythematosus. J. Autoimmun. 27 (2): 110–8. PMID 16890406. doi:10.1016/j.jaut.2006.06.005. 
  15. Bennett CL, Christie J, Ramsdell F, Brunkow ME, Ferguson PJ, Whitesell L, Kelly TE, Saulsbury FT, Chance PF, Ochs HD (January 2001). The immune dysregulation, polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) is caused by mutations of FOXP3. Nat. Genet. 27 (1): 20–1. PMID 11137993. doi:10.1038/83713. 
  16. Tan B, Anaka M, Deb S, Freyer C, Ebert LM, Chueh AC, Al-Obaidi S, Behren A, Jayachandran A, Cebon J, Chen W, Mariadason JM (Dec 20, 2013). FOXP3 over-expression inhibits melanoma tumorigenesis via effects on proliferation and apoptosis.. Oncotarget 5 (1): 264–76. PMC 3960207. PMID 24406338. 

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bettelli E., Dastrange M., Oukka M. (2005). Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.. Proc. Natl. Acad. Sci. U.S.A. 102: 5138 — 5143.  PubMed DOI:10.1073/pnas.0501675102
  • Du J., Huang C., Zhou B., Ziegler S.F. (2008). Isoform-specific inhibition of ROR alpha-mediated transcriptional activation by human FOXP3.. J. Immunol. 180: 4785 — 4792.  PubMed DOI:10.4049/jimmunol.180.7.4785
  • Magg T., Mannert J., Ellwart J.W., Schmid I., Albert M.H. (2012). Subcellular localization of FOXP3 in human regulatory and nonregulatory T cells.. Eur. J. Immunol. 42: 1627 — 1638.  PubMed DOI:10.1002/eji.201141838
  • Lozano T., Casares N., Lasarte J.J. (2013). Searching for the Achilles Heel of FOXP3.. Front. Oncol. 3: 294 — 294.  PubMed DOI:10.3389/fonc.2013.00294
  • Vent-Schmidt J., Han J.M., MacDonald K.G., Levings M.K. (2014). The role of FOXP3 in regulating immune responses.. Int. Rev. Immunol. 33: 110 — 128.  PubMed DOI:10.3109/08830185.2013.811657