GAN

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GAN
Protein GAN PDB 2ppi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GAN, GAN1, KLHL16, gigaxonin, GIG
Зовнішні ІД OMIM: 605379 MGI: 1890619 HomoloGene: 32523 GeneCards: GAN
Шаблон експресії
PBB GE GAN 220124 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_022041
NM_001081151
RefSeq (білок)
NP_071324
NP_001074620
Локус (UCSC) Хр. 16: 81.31 – 81.38 Mb Хр. 8: 117.16 – 117.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GAN (англ. Gigaxonin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 597 амінокислот, а молекулярна маса — 67 638[4].

Послідовність амінокислот
1020304050
MAEGSAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAA
ASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNED
TIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVH
YLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVI
RWIAHDTEIRKVHMKDVMSALWVSGLDSSYLREQMLNEPLVREIVKECSN
IPLSQPQQGEAMLANFKPRGYSECIVTVGGEERVSRKPTAAMRCMCPLYD
PNRQLWIELAPLSMPRINHGVLSAEGFLFVFGGQDENKQTLSSGEKYDPD
ANTWTALPPMNEARHNFGIVEIDGMLYILGGEDGEKELISMECYDIYSKT
WTKQPDLTMVRKIGCYAAMKKKIYAMGGGSYGKLFESVECYDPRTQQWTA
ICPLKERRFGAVACGVAMELYVFGGVRSREDAQGSEMVTCKSEFYHDEFK
RWIYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRS
TGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP

Задіяний у такому біологічному процесі, як убіквітинування білків. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Furukawa M., He Y.J., Borchers C., Xiong Y. (2003). Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.. Nat. Cell Biol. 5: 1001 — 1007.  PubMed DOI:10.1038/ncb1056
  • Wang X.J., Zhang D.D. (2009). Ectodermal-neural cortex 1 down-regulates Nrf2 at the translational level.. PLoS ONE 4: E5492 — E5492.  PubMed DOI:10.1371/journal.pone.0005492

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4137 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9H2C0 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]