GATA4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GATA4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GATA4, GATA binding protein 4, ASD2, TACHD, VSD1, TOF
Зовнішні ІД OMIM: 600576 MGI: 95664 HomoloGene: 1551 GeneCards: GATA4
Пов'язані генетичні захворювання
короткозорість, atrial heart septal defect 2, Тетрада Фалло, testicular anomalies with or without congenital heart disease[1]
Шаблон експресії
PBB GE GATA4 205517 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001308093
NM_001308094
NM_002052
NM_001374273
NM_001374274
NM_008092
NM_001310610
RefSeq (білок)
NP_001295022
NP_001295023
NP_002043
NP_001361202
NP_001361203
NP_001297539
NP_032118
Локус (UCSC) Хр. 8: 11.68 – 11.76 Mb Хр. 14: 63.2 – 63.27 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA4 (англ. GATA binding protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 442 амінокислот, а молекулярна маса — 44 565[5].

Послідовність амінокислот
1020304050
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLG
LSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYT
PPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYG
RAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAA
RHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGI
NRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNS
SNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVL
SALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Huang W.Y., Cukerman E., Liew C.C. (1995). Identification of a GATA motif in the cardiac alpha-myosin heavy-chain-encoding gene and isolation of a human GATA-4 cDNA.. Gene 155: 219 — 223.  PubMed DOI:10.1016/0378-1119(94)00893-W
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tomita-Mitchell A., Maslen C.L., Morris C.D., Garg V., Goldmuntz E. (2007). GATA4 sequence variants in patients with congenital heart disease.. J. Med. Genet. 44: 779 — 783.  PubMed DOI:10.1136/jmg.2007.052183
  • Peng T., Wang L., Zhou S.F., Li X. (2010). Mutations of the GATA4 and NKX2.5 genes in Chinese pediatric patients with non-familial congenital heart disease.. Genetica 138: 1231 — 1240.  PubMed DOI:10.1007/s10709-010-9522-4

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]