GCH1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GCH1
Protein GCH1 PDB 1fb1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GCH1, DYT14, DYT5, DYT5a, GCH, GTP-CH-1, GTPCH1, HPABH4B, GTP cyclohydrolase 1
Зовнішні ІД MGI: 95675 HomoloGene: 132 GeneCards: GCH1
Пов'язані генетичні захворювання
Ожиріння, Ревматоїдний артрит[1]
Шаблон експресії
PBB GE GCH1 204224 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000161
NM_001024024
NM_001024070
NM_001024071
NM_008102
RefSeq (білок)
NP_000152
NP_001019195
NP_001019241
NP_001019242
NP_032128
Локус (UCSC) Хр. 14: 54.84 – 54.9 Mb Хр. 14: 47.15 – 47.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GCH1 (англ. GTP cyclohydrolase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 250 амінокислот, а молекулярна маса — 27 903[5].

Послідовність амінокислот
1020304050
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPA
DGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAAS
AMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVG
KVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA
GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

Кодований геном білок за функціями належить до гідролаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, іонами металів, іоном цинку, ГТФ. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Togari A., Ichinose H., Matsumoto S., Fujita K., Nagatsu T. (1992). Multiple mRNA forms of human GTP cyclohydrolase I.. Biochem. Biophys. Res. Commun. 187: 359 — 365.  PubMed DOI:10.1016/S0006-291X(05)81501-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Blau N., Niederwieser A. (1986). The application of 8-aminoguanosine triphosphate, a new inhibitor of GTP cyclohydrolase I, to the purification of the enzyme from human liver.. Biochim. Biophys. Acta 880: 26 — 31.  PubMed DOI:10.1016/0304-4165(86)90115-7
  • Shen R.-S., Alam A., Zhang Y.X. (1989). Human liver GTP cyclohydrolase I: purification and some properties.. Biochimie 71: 343 — 349.  PubMed DOI:10.1016/0300-9084(89)90006-0
  • Schoedon G., Redweik U., Curtius H.-C. (1989). Purification of GTP cyclohydrolase I from human liver and production of specific monoclonal antibodies.. Eur. J. Biochem. 178: 627 — 634.  PubMed DOI:10.1111/j.1432-1033.1989.tb14491.x
  • Thoeny B., Blau N. (1997). Mutations in the GTP cyclohydrolase I and 6-pyruvoyl-tetrahydropterin synthase genes.. Hum. Mutat. 10: 11 — 20.  PubMed DOI:10.1002/(SICI)1098-1004(1997)10:1<11::AID-HUMU2>3.0.CO;2-P

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]