GLP1R

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GLP1R
Protein GLP1R PDB 3C59.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GLP1R, entrez:2740, glucagon-like peptide 1 receptor, GLP-1, GLP-1-R, GLP-1R, glucagon like peptide 1 receptor
Зовнішні ІД OMIM: 138032 MGI: 99571 HomoloGene: 1558 GeneCards: GLP1R
Шаблон експресії
PBB GE GLP1R 208390 s at fs.png

PBB GE GLP1R 208391 s at fs.png

PBB GE GLP1R 208401 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002062
NM_021332
RefSeq (білок)
NP_002053
NP_067307
Локус (UCSC) Хр. 6: 39.05 – 39.09 Mb Хр. 17: 30.9 – 30.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GLP1R (англ. Glucagon like peptide 1 receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 463 амінокислот, а молекулярна маса — 53 026[4].

Послідовність амінокислот
1020304050
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSL
TEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHV
YRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLYIIYTV
GYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAA
LKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVY
LYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLA
KSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAI
LYCFVNNEVQLEFRKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGATAG
SSMYTATCQASCS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Graziano M.P., Hey P.J., Borkowski D., Chicchi G.C., Strader C.D. (1993). Cloning and functional expression of a human glucagon-like peptide-1 receptor.. Biochem. Biophys. Res. Commun. 196: 141 — 146.  PubMed DOI:10.1006/bbrc.1993.2226
  • van Eyll B., Lankat-Buttgereit B., Bode H.P., Goeke R., Goeke B. (1994). Signal transduction of the GLP-1-receptor cloned from a human insulinoma.. FEBS Lett. 348: 7 — 13.  PubMed DOI:10.1016/0014-5793(94)00553-2
  • Wei Y., Mojsov S. (1995). Tissue-specific expression of the human receptor for glucagon-like peptide-I: brain, heart and pancreatic forms have the same deduced amino acid sequences.. FEBS Lett. 358: 219 — 224.  PubMed DOI:10.1016/0014-5793(94)01430-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lankat-Buttgereit B., Goeke B. (1997). Cloning and characterization of the 5' flanking sequences (promoter region) of the human GLP-1 receptor gene.. Peptides 18: 617 — 624.  PubMed DOI:10.1016/S0196-9781(97)00001-6
  • Mann R.J., Al-Sabah S., de Maturana R.L., Sinfield J.K., Donnelly D. (2010). Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1) receptor indicates a disulfide bond that is close to the activation pocket.. Peptides 31: 2289 — 2293.  PubMed DOI:10.1016/j.peptides.2010.09.015

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4324 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P43220 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]