GPR174

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GPR174
Ідентифікатори
Символи GPR174, GPCR17, LYPSR3, FKSG79, G protein-coupled receptor 174
Зовнішні ІД OMIM: 300903 MGI: 2685222 HomoloGene: 13059 GeneCards: GPR174
Шаблон експресії
PBB GE GPR174 gnf1h00808 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032553
NM_001033251
NM_001177781
NM_001177782
NM_001358747
RefSeq (білок)
NP_115942
NP_001028423
NP_001171252
NP_001171253
NP_001345676
Локус (UCSC) Хр. X: 79.14 – 79.18 Mb Хр. X: 107.26 – 107.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GPR174 (англ. G protein-coupled receptor 174) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 333 амінокислот, а молекулярна маса — 38 503[4].

Послідовність амінокислот
1020304050
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKE
TKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYV
NMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICLACV
LFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLI
VLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSF
PLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR
RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S. (2002). Identification of G protein-coupled receptor genes from the human genome sequence.. FEBS Lett. 520: 97 — 101.  PubMed DOI:10.1016/S0014-5793(02)02775-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30245 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9BXC1 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]