HDAC7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HDAC7
Protein HDAC7A PDB 2nvr.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HDAC7, HD7A, HDAC7A, HD7, histone deacetylase 7
Зовнішні ІД OMIM: 606542 MGI: 1891835 HomoloGene: 9124 GeneCards: HDAC7
Пов'язані генетичні захворювання
Ожиріння[1]
Реагує на сполуку
Belinostat, givinostat, panobinostat, quisinostat, romidepsin, trichostatin A[2]
Шаблон експресії
PBB GE HDAC7A 217937 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001098416
NM_001308090
NM_015401
NM_016596
NM_001368046
RefSeq (білок)
NP_001091886
NP_001295019
NP_056216
NP_001354975
Локус (UCSC) Хр. 12: 47.78 – 47.83 Mb Хр. 15: 97.79 – 97.84 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HDAC7 (англ. Histone deacetylase 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 952 амінокислот, а молекулярна маса — 102 927[6].

Послідовність амінокислот
1020304050
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSM
DTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAA
LERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPL
RKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPS
SSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSVAPFALPTVSL
LPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLH
WPLSRTRSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRL
RQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAPLQQHPQVLL
WEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAAPASLSAPEPA
SQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQS
IWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAF
KVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASK
ILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAG
SGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGF
DAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICD
ASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPM
NL

Кодований геном білок за функціями належить до репресорів, гідролаз, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee H.-J., Chun M., Kandror K.V. (2001). Tip60 and HDAC7 interact with the endothelin receptor a and may be involved in downstream signaling.. J. Biol. Chem. 276: 16597 — 16600.  PubMed DOI:10.1074/jbc.C000909200
  • Bryant H., Farrell P.J. (2002). Signal transduction and transcription factor modification during reactivation of Epstein-Barr virus from latency.. J. Virol. 76: 10290 — 10298.  PubMed DOI:10.1128/JVI.76.20.10290-10298.2002
  • Xiao H., Chung J., Kao H.-Y., Yang Y.-C. (2003). Tip60 is a co-repressor for STAT3.. J. Biol. Chem. 278: 11197 — 11204.  PubMed DOI:10.1074/jbc.M210816200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]