HIP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIP1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HIP1, HIP-I, ILWEQ, SHON, SHONbeta, SHONgamma, huntingtin interacting protein 1
Зовнішні ІД OMIM: 601767 MGI: 1099804 HomoloGene: 68463 GeneCards: HIP1
Пов'язані генетичні захворювання
alcohol abuse[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243198
NM_005338
NM_146001
RefSeq (білок)
NP_001230127
NP_005329
NP_666113
Локус (UCSC) Хр. 7: 75.53 – 75.74 Mb Хр. 5: 135.41 – 135.55 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIP1 (англ. Huntingtin interacting protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 037 амінокислот, а молекулярна маса — 116 221[5].

Послідовність амінокислот
1020304050
MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINT
QEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFH
KLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKM
EYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ
TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCL
PADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDI
FGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQR
VVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKA
QRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMAR
QAQVDLEREKKELEDSLERISDQGQRKTQEQLEVLESLKQELATSQRELQ
VLQGSLETSAQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQD
TQLKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISC
AGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTS
DAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADS
TAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATAR
IEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVE
SGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKF
EELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVV
ASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQK
LGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, ендоцитоз, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, ядрі, мембрані, цитоплазматичних везикулах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chen C.-Y., Brodsky F.M. (2005). Huntingtin-interacting protein 1 (Hip1) and Hip1-related protein (Hip1R) bind the conserved sequence of clathrin light chains and thereby influence clathrin assembly in vitro and actin distribution in vivo.. J. Biol. Chem. 280: 6109 — 6117.  PubMed DOI:10.1074/jbc.M408454200
  • Ybe J.A., Mishra S., Helms S., Nix J. (2007). Crystal structure at 2.8 A of the DLLRKN-containing coiled-coil domain of huntingtin-interacting protein 1 (HIP1) reveals a surface suitable for clathrin light chain binding.. J. Mol. Biol. 367: 8 — 15.  PubMed DOI:10.1016/j.jmb.2006.12.052
  • Niu Q., Ybe J.A. (2008). Crystal structure at 2.8 A of Huntingtin-interacting protein 1 (HIP1) coiled-coil domain reveals a charged surface suitable for HIP1 protein interactor (HIPPI).. J. Mol. Biol. 375: 1197 — 1205.  PubMed DOI:10.1016/j.jmb.2007.11.036
  • Ross T.S., Bernard O.A., Berger R., Gilliland D.G. (1998). Fusion of Huntingtin interacting protein 1 to platelet-derived growth factor beta receptor (PDGFbetaR) in chronic myelomonocytic leukemia with t(5;7)(q33;q11.2).. Blood 91: 4419 — 4426.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]