HIVEP3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIVEP3
Ідентифікатори
Символи HIVEP3, Hivep3, 2900056N03Rik, A130075N07, AI848000, E030045D18Rik, KBP-1, KBP1, Rc, Schnurri-3, Shn3, Zas3, ZNF40C, human immunodeficiency virus type I enhancer binding protein 3, Kappa Recognition Component (Krc), KRC, HIVEP zinc finger 3
Зовнішні ІД OMIM: 606649 MGI: 106589 HomoloGene: 7803 GeneCards: HIVEP3
Шаблон експресії
PBB GE HIVEP3 220042 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127714
NM_024503
NM_010657
RefSeq (білок)
NP_001121186
NP_078779
NP_034787
Локус (UCSC) Хр. 1: 41.51 – 42.04 Mb Хр. 4: 119.73 – 120.14 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIVEP3 (англ. Human immunodeficiency virus type I enhancer binding protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 406 амінокислот, а молекулярна маса — 259 465[4].

Послідовність амінокислот
1020304050
MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPA
QELLAPQPFPGPSSVLREGSQEKTGQQQKPPKRPPIEASVHISQLPQHPL
TPAFMSPGKPEHLLEGSTWQLVDPMRPGPSGSFVAPGLHPQSQLLPSHAS
IIPPEDLPGVPKVFVPRPSQVSLKPTEEAHKKERKPQKPGKYICQYCSRP
CAKPSVLQKHIRSHTGERPYPCGPCGFSFKTKSNLYKHRKSHAHRIKAGL
ASGMGGEMYPHGLEMERIPGEEFEEPTEGESTDSEEETSATSGHPAELSP
RPKQPLLSSGLYSSGSHSSSHERCSLSQSSTAQSLEDPPPFVEPSSEHPL
SHKPEDTHTIKQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESA
EQQVSPPNTNAKSYAEIIFGKCGRIGQRTAMLTATSTQPLLPLSTEDKPS
LVPLSVPRTQVIEHITKLITINEAVVDTSEIDSVKPRRSSLSRRSSMESP
KSSLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRSHSMPSAACTI
STPHHPFRGSYSFDDHITDSEALSHSSHVFTSHPRMLKRQPAIELPLGGE
YSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGA
RYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMH
YKLGTTLELTPLRKRRKEKSLGDEEEPPAFESTKSQFGSPGPSDAARNLP
LESTKSPAEPSKSVPSLEGPTGFQPRTPKPGSGSESGKERRTTSKEISVI
QHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPPAPHGRSAHSLQPKLVRQ
PNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEK
LPPKKKRLRLAEMAQSSGESSFESSVPLSRSPSQESNVSLSGSSRSASFE
RDDHGKAEAPSPSSDMRPKPLGTHMLTVPSHHPHAREMRRSASEQSPNVS
HSAHMTETRSKSFDYGSLSLTGPSAPAPVAPPARVAPPERRKCFLVRQAS
LSRPPESELEVAPKGRQESEEPQPSSSKPSAKSSLSQISSAATSHGGPPG
GKGPGQDRPPLGPTVPYTEALQVFHHPVAQTPLHEKPYLPPPVSLFSFQH
LVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPPLPLQPTVLHP
GQLHLPQLMPHPANIPFRQPPSFLPMPYPTSSALSSGFFLPLQSQFALQL
PGDVESHLPQIKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPT
SAPPLALPACPDTMVSLVVPVRVQTNMPSYGSAMYTTLSQILVTQSQGSS
ATVALPKFEEPPSKGTTVCGADVHEVGPGPSGLSEEQSRAFPTPYLRVPV
TLPERKGTSLSSESILSLEGSSSTAGGSKRVLSPAGSLELTMETQQQKRV
KEEEASKADEKLELVKPCSVVLTSTEDGKRPEKSHLGNQGQGRRELEMLS
SLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGKPHRRGLTPLS
VKKEDSKEQPDLPSLAPPSSLPLSETSSRPAKSQEGTDSKKVLQFPSLHT
TTNVSWCYLNYIKPNHIQHADRRSSVYAGWCISLYNPNLPGVSTKAALSL
LRSKQKVSKETYTMATAPHPEAGRLVPSSSRKPRMTEVHLPSLVSPEGQK
DLARVEKEEERRGEPEEDAPASQRGEPARIKIFEGGYKSNEEYVYVRGRG
RGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKH
MKSKAHSKKCQETGVLEELEAEEGTSDDLFQDSEGREGSEAVEEHQFSDL
EDSDSDSDLDEDEDEDEEESQDELSRPSSEAPPPGPPHALRADSSPILGP
QPPDAPASGTEATRGSSVSEAERLTASSCSMSSQSMPGLPWLGPAPLGSV
EKDTGSALSYKPVSPRRPWSPSKEAGSRPPLARKHSLTKNDSSPQRCSPA
REPQASAPSPPGLHVDPGRGMGALPCGSPRLQLSPLTLCPLGRELAPRAH
VLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSAPPGKWALAGPGSPSAG
EHGPGLGLDPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPA
HPLSSRPFSALHDFHGHILARTEENIFSHLPLHSQHLTRAPCPLIPIGGI
QMVQARPGAHPTLLPGPTAAWVSGFSGGGSDLTGAREAQERGRWSPTESS
SASVSPVAKVSKFTLSSELEGGDYPKERERTGGGPGRPPDWTPHGTGAPA
EPTPTHSPCTPPDTLPRPPQGRRAAQSWSPRLESPRAPTNPEPSATPPLD
RSSSVGCLAEASARFPARTRNLSGEPRTRQDSPKPSGSGEPRAHPHQPED
RVPPNA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Hicar M.D., Liu Y., Allen C.E., Wu L.-C. (2001). Structure of the human zinc finger protein HIVEP3: molecular cloning, expression, exon-intron structure, and comparison with paralogous genes HIVEP1 and HIVEP2.. Genomics 71: 89 — 100.  PubMed DOI:10.1006/geno.2000.6425
  • Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 273 — 281.  PubMed DOI:10.1093/dnares/7.4.271
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13561 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q5T1R4 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]