HOXA7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXA7
Protein HOXA7 PDB 1ahd.png
Ідентифікатори
Символи HOXA7, ANTP, HOX1, HOX1.1, HOX1A, homeobox A7
Зовнішні ІД OMIM: 142950 MGI: 96179 HomoloGene: 56001 GeneCards: HOXA7
Шаблон експресії
PBB GE HOXA7 206847 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006896
NM_010455
RefSeq (білок)
NP_008827
NP_034585
Локус (UCSC) Хр. 7: 27.15 – 27.16 Mb Хр. 6: 52.21 – 52.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXA7 (англ. Homeobox A7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 230 амінокислот, а молекулярна маса — 25 355[4].

Послідовність амінокислот
1020304050
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
VPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGA
CDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH
FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAP
EGAVPSAAATAAADKADEEDDDEEEEDEEE

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • La Celle P.T., Polakowska R.R. (2001). Human homeobox HOXA7 regulates keratinocyte transglutaminase type 1 and inhibits differentiation.. J. Biol. Chem. 276: 32844 — 32853.  PubMed DOI:10.1074/jbc.M104598200
  • Kim M.H., Jin H., Seol E.Y., Yoo M., Park H.W. (2000). Sequence analysis and tissue specific expression of human HOXA7.. Mol. Biotechnol. 14: 19 — 24.  PubMed DOI:10.1385/MB:14:1:19

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5108 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P31268 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]