ID4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ID4
Ідентифікатори
Символи ID4, IDB4, bHLHb27, inhibitor of DNA binding 4, HLH protein
Зовнішні ІД OMIM: 600581 MGI: 99414 HomoloGene: 1186 GeneCards: ID4
Шаблон експресії
PBB GE ID4 209292 at fs.png

PBB GE ID4 209291 at fs.png

PBB GE ID4 209293 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001546
NM_031166
RefSeq (білок)
NP_001537
NP_112443
Локус (UCSC) Хр. 6: 19.84 – 19.84 Mb Хр. 13: 48.26 – 48.27 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ID4 (англ. Inhibitor of DNA binding 4, HLH protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 161 амінокислот, а молекулярна маса — 16 622[4].

Послідовність амінокислот
1020304050
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARC
KAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
ILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGA
VNKQGDSILCR

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • Pagliuca A., Bartoli P.C., Saccone S., Della Valle G., Lania L. (1995). Molecular cloning of ID4, a novel dominant negative helix-loop-helix human gene on chromosome 6p21.3-p22.. Genomics 27: 200 — 203.  PubMed DOI:10.1006/geno.1995.1026
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5363 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P47928 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]