IFNG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IFNG
IFN.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IFNG, IFG, IFI, interferon, gamma, interferon gamma
Зовнішні ІД MGI: 107656 HomoloGene: 55526 GeneCards: IFNG
Шаблон експресії
PBB GE IFNG 210354 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000619
NM_008337
RefSeq (білок)
NP_000610
NP_032363
Локус (UCSC) Хр. 12: 68.15 – 68.16 Mb Хр. 10: 118.44 – 118.45 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IFNG (англ. Interferon gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 166 амінокислот, а молекулярна маса — 19 348[4].

Послідовність амінокислот
1020304050
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGT
LFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDM
NVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTG
KRKRSQMLFRGRRASQ

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як регуляція росту, противірусний захист. Секретований назовні.

Література[ред. | ред. код]

  • Gray P.W., Goeddel D.V. (1982). Structure of the human immune interferon gene.. Nature 298: 859 — 863.  PubMed DOI:10.1038/298859a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Pan Y.C.E., Stern A.S., Familletti P.C., Khan F.R., Chizzonite R. (1987). Structural characterization of human interferon gamma. Heterogeneity of the carboxyl terminus.. Eur. J. Biochem. 166: 145 — 149.  PubMed DOI:10.1111/j.1432-1033.1987.tb13494.x
  • Rinderknecht E., O'Conner B.H., Rodriguez H. (1984). Natural human interferon-gamma. Complete amino acid sequence and determination of sites of glycosylation.. J. Biol. Chem. 259: 6790 — 6797.  PubMed
  • Yamamoto S., Hase S., Yamauchi H., Tanimoto T., Ikenaka T. (1989). Studies on the sugar chains of interferon-gamma from human peripheral-blood lymphocytes.. J. Biochem. 105: 1034 — 1039.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5438 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P01579 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]