IKZF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IKZF2
Ідентифікатори
Символи IKZF2, ANF1A2, HELIOS, ZNF1A2, ZNFN1A2, IKAROS family zinc finger 2
Зовнішні ІД OMIM: 606234 MGI: 1342541 HomoloGene: 22659 GeneCards: IKZF2
Шаблон експресії
PBB GE IKZF2 220567 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011770
RefSeq (білок)
NP_035900
Локус (UCSC) Хр. 2: 213 – 213.15 Mb Хр. 1: 69.53 – 69.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IKZF2 (англ. IKAROS family zinc finger 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 526 амінокислот, а молекулярна маса — 59 574[4].

Послідовність амінокислот
1020304050
METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSV
KLEMQSDEECDRKPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQELQ
GEGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFT
QKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNY
CGRSYKQRSSLEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDCKEQEPI
MDNNISLVPFERPAVIEKLTGNMGKRKSSTPQKFVGEKLMRFSYPDIHFD
MNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPV
ISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASP
SNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALDTTKAP
KGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHMGCHGYRDPLE
CNICGYRSQDRYEFSSHIVRGEHTFH

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hosokawa Y., Maeda Y., Seto M. (1999). Human Helios, an Ikaros-related zinc finger DNA binding protein: cDNA cloning and tissue expression pattern.. Immunogenetics 50: 106 — 108.  PubMed DOI:10.1007/s002510050696
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Perdomo J., Holmes M., Chong B., Crossley M. (2000). Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.. J. Biol. Chem. 275: 38347 — 38354.  PubMed DOI:10.1074/jbc.M005457200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13177 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9UKS7 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]