ITPR2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ITPR2
Ідентифікатори
Символи ITPR2, CFAP48, IP3R2, ANHD, INSP3R2, inositol 1,4,5-trisphosphate receptor type 2
Зовнішні ІД MGI: 99418 HomoloGene: 37593 GeneCards: ITPR2
Пов'язані генетичні захворювання
Аміотрофічний бічний склероз[1]
Реагує на сполуку
adenophostin A[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002223
NM_010586
NM_019923
RefSeq (білок)
NP_002214
NP_034716
NP_064307
Локус (UCSC) Хр. 12: 26.34 – 26.83 Mb Хр. 6: 146.11 – 146.5 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ITPR2 (англ. Inositol 1,4,5-trisphosphate receptor type 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 2 701 амінокислот, а молекулярна маса — 308 064[6].

Послідовність амінокислот
1020304050
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPP
KKFRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQ
KQNESENKKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVS
LDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIEL
LDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVVRLFHAEQEKF
LTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKI
MYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTS
TSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANK
VLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVVITK
PNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYK
YMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQE
LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDS
NKEPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAIN
QISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRY
ARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEYLKEVVNQPF
PFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSI
HPSKQGSPTEHEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEF
GEDNDNAETSASGSPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLD
DEGGRTFLRVLIHLIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLL
VSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEIGESQVKGGE
EPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNP
QNQVLLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCI
ETHGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDVLIFYNDRA
SFPILLHMMCSERDRGDESGPLAYHITLVELLAACTEGKNVYTEIKCNSL
LPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKL
FENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIA
IPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYR
NIIEKLQDVVASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCG
AFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFVEEGNTLRKILL
NRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSDIQCLLD
KEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRM
RVRDSTLHLKEGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGN
TEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYN
LVCETLQFLDCICGSTTGGLGLLGLYINEKNVALVNQNLESLTEYCQGPC
HENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLA
IMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIE
IVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQT
EDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPF
GDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPVGIRPFLVSIMLRSIY
TIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDMAFLYHV
AYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMME
ACAKENCSPTIPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGV
GDVLRRPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSE
KQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVK
VKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQ
EKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, транспорт кальцію, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Futatsugi A., Kuwajima G., Mikoshiba K. (1998). Muscle-specific mRNA isoform encodes a protein composed mainly of the N-terminal 175 residues of type 2 Ins(1,4,5)P3 receptor.. Biochem. J. 334: 559 — 563.  PubMed DOI:10.1042/bj3340559

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]