JADE3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JADE3
Ідентифікатори
Символи JADE3, JADE-3, PHF16, jade family PHD finger 3
Зовнішні ІД OMIM: 300618 MGI: 2148019 HomoloGene: 40981 GeneCards: JADE3
Шаблон експресії
PBB GE PHF16 204866 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014735
NM_001077445
NM_001289684
NM_199317
RefSeq (білок)
NP_001070913
NP_055550
NP_001276613
NP_955021
Локус (UCSC) Хр. X: 46.91 – 47.06 Mb Хр. X: 20.43 – 20.52 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JADE3 (англ. Jade family PHD finger 3) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 823 амінокислот, а молекулярна маса — 93 808[4].

Послідовність амінокислот
1020304050
MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLIS
AMKLPDSHHINPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEK
VKDVLFIRPRKYIHCSSPDTTEPGYINIMELAASVCRYDLDDMDIFWLQE
LNEDLAEMGCGPVDENLMEKTVEVLERHCHENMNHAIETEEGLGIEYDED
VICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEGSWLCRSCVLG
IYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTIL
DEGDEVKFKSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKL
RELEEEFYSLVRVEDVAAELGMPTLAVDFIYNYWKLKRKSNFNKPLFPPK
EDEENGLVQPKEESIHTRMRMFMHLRQDLERVRNLCYMISRREKLKLSHN
KIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRITLKLKMPKSTP
EDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQS
SIGNGKSQPNSKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVS
QGSFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQ
VLRRSAGRAPYQENDGYCPDLELSDSEAESDGNKEKVRVRKDSSDRENPP
HDSRRDCHGKSKTHPLSHSSMQR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tzouanacou E., Tweedie S., Wilson V. (2003). Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development.. Mol. Cell. Biol. 23: 8553 — 8562.  PubMed DOI:10.1128/MCB.23.23.8553-8562.2003
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:22982 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, Q92613 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]