JDP2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JDP2
Ідентифікатори
Символи JDP2, JUNDM2, Jun dimerization protein 2
Зовнішні ІД OMIM: 608657 MGI: 1932093 HomoloGene: 12787 GeneCards: JDP2
Пов'язані генетичні захворювання
Ожиріння[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001135047
NM_001135048
NM_001135049
NM_130469
NM_001205052
NM_001205053
NM_030887
RefSeq (білок)
NP_001128519
NP_001128520
NP_001128521
NP_569736
NP_001191981
NP_001191982
NP_112149
Локус (UCSC) Хр. 14: 75.43 – 75.47 Mb Хр. 12: 85.6 – 85.64 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JDP2 (англ. Jun dimerization protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 163 амінокислот, а молекулярна маса — 18 704[5].

Послідовність амінокислот
1020304050
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPL
HFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFL
QRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPE
SEGNPLLEQLEKK

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Murata T., Shinozuka Y., Obata Y., Yokoyama K.K. (2008). Phosphorylation of two eukaryotic transcription factors, Jun dimerization protein 2 and activation transcription factor 2, in Escherichia coli by Jun N-terminal kinase 1.. Anal. Biochem. 376: 115 — 121.  PubMed DOI:10.1016/j.ab.2008.01.038
  • Kimura M. (2008). IRF2-binding protein-1 is a JDP2 ubiquitin ligase and an inhibitor of ATF2-dependent transcription.. FEBS Lett. 582: 2833 — 2837.  PubMed DOI:10.1016/j.febslet.2008.07.033
  • Jin C., Li H., Ugai H., Murata T., Yokoyama K.K. (2002). Transcriptional regulation of the c-jun gene by AP-1 repressor protein JDP2 during the differentiation of F9 cells.. Nucleic Acids Res. Suppl. 2: 97 — 98.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]