KCNH2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KCNH2
PBB Protein KCNH2 image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KCNH2, ERG-1, ERG1, H-ERG, HERG, HERG1, Kv11.1, LQT2, SQT1, potassium voltage-gated channel subfamily H member 2
Зовнішні ІД MGI: 1341722 HomoloGene: 201 GeneCards: KCNH2
Реагує на сполуку
rottlerin, Дизопірамід, Дофетилід, Астемізол, E4031, ibutilide, Терфенадин[1]
Шаблон експресії
PBB GE KCNH2 205262 at fs.png

PBB GE KCNH2 gnf1h06648 at fs.png

PBB GE KCNH2 210036 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000238
NM_001204798
NM_172056
NM_172057
NM_001294162
NM_013569
RefSeq (білок)
NP_000229
NP_001191727
NP_742053
NP_742054
NP_001281091
NP_038597
Локус (UCSC) Хр. 7: 150.94 – 150.98 Mb Хр. 5: 24.32 – 24.35 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KCNH2 (англ. Potassium voltage-gated channel subfamily H member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 159 амінокислот, а молекулярна маса — 126 655[5].

Послідовність амінокислот
1020304050
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCE
LCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYR
KDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGP
PTSWLAPGRAKTFRLKLPALLALTARESSVRSGGAGGAGAPGAVVVDVDL
TPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSPPRSAPGQLPS
PRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLA
SPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTI
LHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQ
PLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLI
DMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVL
FLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSL
MYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEY
FQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGC
LRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILG
KNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSD
HFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS
SPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSF
WGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLN
RLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPL
PTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPL
HRHGSDPGS

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, транспорт калію, альтернативний сплайсинг. Білок має сайт для зв'язування з калію. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Warmke J.W., Ganetzky B. (1994). A family of potassium channel genes related to eag in Drosophila and mammals.. Proc. Natl. Acad. Sci. U.S.A. 91: 3438 — 3442.  PubMed DOI:10.1073/pnas.91.8.3438
  • Lees-Miller J.P., Kondo C., Wang L., Duff H.J. (1997). Electrophysiological characterization of an alternatively processed ERG K+ channel in mouse and human hearts.. Circ. Res. 81: 719 — 726.  PubMed DOI:10.1161/01.RES.81.5.719
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kupershmidt S., Snyders D.J., Raes A., Roden D.M. (1998). A K+ channel splice variant common in human heart lacks a C-terminal domain required for expression of rapidly activating delayed rectifier current.. J. Biol. Chem. 273: 27231 — 27235.  PubMed DOI:10.1074/jbc.273.42.27231
  • Gong Q., Anderson C.L., January C.T., Zhou Z. (2002). Role of glycosylation in cell surface expression and stability of HERG potassium channels.. Am. J. Physiol. 283: H77 — H84.  PubMed DOI:10.1152/ajpheart.00008.2002
  • Cui J., Melman Y., Palma E., Fishman G.I., McDonald T.V. (2000). Cyclic AMP regulates the HERG K(+) channel by dual pathways.. Curr. Biol. 10: 671 — 674.  PubMed DOI:10.1016/S0960-9822(00)00516-9

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]